IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A conserved f box regulatory complex controls proteasome activity in Drosophila. A conserved f box regulatory complex controls proteasome activity in Drosophila. Cell (0092-8674) 2011 imex curation Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. Proteins lacking fluorescent tags visualised by immunostaining steller@rockefeller.edu Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A conserved f box regulatory complex controls proteasome activity in Drosophila. A conserved f box regulatory complex controls proteasome activity in Drosophila. Cell (0092-8674) 2011 imex curation Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions drome-testis Drosophila melanogaster testis anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A conserved f box regulatory complex controls proteasome activity in Drosophila. A conserved f box regulatory complex controls proteasome activity in Drosophila. Cell (0092-8674) 2011 imex curation Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A conserved f box regulatory complex controls proteasome activity in Drosophila. A conserved f box regulatory complex controls proteasome activity in Drosophila. Cell (0092-8674) 2011 imex curation Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions drome-testis Drosophila melanogaster testis anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A conserved f box regulatory complex controls proteasome activity in Drosophila. A conserved f box regulatory complex controls proteasome activity in Drosophila. Cell (0092-8674) 2011 imex curation Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bader M., Benjamin S., Wapinski O.L., Smith D.M., Goldberg A.L., Steller H. steller@rockefeller.edu Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation psmf1_drome Proteasome inhibitor PI31 subunit PI31 CG8979 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MESGSTAKTGDFFYGWDLLYKTVKADVSKKSDLLIALVHFLLTKHYNFRCVGVGDDKTLPEEEGSELLPDSWNDDDTKYSLRYVHDKMLYLLLGHITEGSLLINLLDINTKKVSNICVEPETLVPEVKGGITTIMPSASEIVERYRRELLDPVFTGNSREVTTQTTNSPRPIGSDPDPLRIGEPRRGGSFIPSAFEPRPFGFPDVGRGDLDPLGRGGHGNLFSFPSRPNMGPGPVPRFDPFNPLNPNRPGQGGINPDHMRPPDWNPDYYM F7972E7634E80555 psa1_drome Proteasome subunit alpha type-1 Prosalpha6 PROS-35 PROS-Dm35 Pros35 Proteasome 35 kDa subunit CG4904 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPRNDDDDDRPSPPEEPAAGPRDPEVLVATEQRP 1478BDC2C61EF3F1 nutc_drome Protein nutcracker CG10855 ntc protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDTKSEIEGFIAIPTTSGEQQQQQPQQQQNEQQVVGTKDIKAPDQVGKKQRPRLIQEKSTQETNPLILEHATLEWVPQHMDKLLNQYQECRKMPAAEWLHLLTYLVALECGFVEEETFAQKRHLIQPVPSFSSFHAQNVRILSEQPARYEVCFNDTVYIMRLRTLLDKHAPEETSLVAALQCRLMAVSLGDQLMITLSPAPPSKEPGYSVSLSIGRYVLNIQAKNKPIYHRFRKLDELSYQLKQHLFQPMRSQQLMQMEMKLQPSLLGLPDELYFEIFRYLDKSQLNVVARVNRHLHFYSKEVERKRLKGGRS 5D0F06B57D952BF9 ntc-pros35 3 8 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association Fig. 1B, Supp. Fig. 1A Proteasome subunit alpha type-7 was also identified but could not be ascribed to a single gene product. ntc-pros35-1 4 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Proteasome subunit alpha type-7 was also identified but could not be ascribed to a single gene product. Fig. 1A, Supp. Fig. 1B ntc-pros35-2 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1D, 3C Ntc also interacted with proteasome subunit alpha7 but this could not be ascribed to a single gene product. ntc-pros35-3 5 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait Q8SX86:p.Val188Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E Wed May 02 19:42:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val188glu' Tue Jun 30 18:25:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val188Glu' region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1E ntc-psmf1 1 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Supp. Fig. 2