MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structure of the intraflagellar transport complex 25/27. Crystal structure of the intraflagellar transport complex 25/27. EMBO J. (0261-4189) 2011 imex curation Bhogaraju S., Taschner M., Morawetz M., Basquin C., Lorentzen E. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bhogaraju S., Taschner M., Morawetz M., Basquin C., Lorentzen E. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Crystal structure of the intraflagellar transport complex 25/27. Crystal structure of the intraflagellar transport complex 25/27. EMBO J. (0261-4189) 2011 imex curation Bhogaraju S., Taschner M., Morawetz M., Basquin C., Lorentzen E. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bhogaraju S., Taschner M., Morawetz M., Basquin C., Lorentzen E. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation ift25_chlre Intraflagellar transport protein 25 IFT25 FAP232 Flagellar-associated protein 232 CHLREDRAFT_98791 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MKDYAREENGGLVVMASCSDERFPPENMLDGKDNTFWVTTGMFPQEFVLRLESCIRVSKITTLSLNVRKLAVEKCDQDKPDQFEKVFEVELANRGDRLQTEVHQVNIRAKYLKFILLQGHGEFATVNRVSVVGGDDDGGGYDEPGGGYGSMQRQPSMGYGGGGGSAATGFAADPGNAAAGGGGGFEDEF mint EAD121E6AAE928EB ift27_chlre Intraflagellar transport protein 27 IFT27 FAP156 Flagellar-associated protein 156 CHLREDRAFT_129193 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MVKKEVKPIDITATLRCKVAVVGEATVGKSALISMFTSKGSKFLKDYAMTSGVEVVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKTDLPPQRHQVRLDMAQDWATTNTLDFFDVSANPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY mint 2FA9BECF50CC0876 b8lix8-fap156 2 IFT25 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain IFT27 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint The coordinates and structure factors have been deposited in the pdb under the accession codes 2yc2 and 2yc4. t1 f1 f2a f5 fap156-b8lix8 1 IFT25 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell B8LIX8:p.Thr40Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T R Tue Jul 12 10:52:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:44:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr40arg' Tue Jun 30 18:41:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr40Arg' B8LIX8:p.Val38Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V R Tue Jul 12 10:52:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:05:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val38arg' Tue Jun 30 19:50:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val38Arg' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined B8LIX8:p.Thr125Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E Tue Jul 12 10:12:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:55:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr125glu' Tue Jun 30 16:50:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr125Glu' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain IFT27 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f2b sf5a b8lix8-fap156-1 1 IFT27 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell IFT25 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell B8LIX8:p.Val38Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V R Tue Jul 12 10:52:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:08:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val38arg' Tue Jun 30 16:25:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val38Arg' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined B8LIX8:p.Thr125Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E Tue Jul 12 10:52:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:09:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr125glu' Tue Jun 30 18:36:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr125Glu' B8LIX8:p.Thr40Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T R Tue Jul 12 10:52:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:58:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr40arg' Tue Jun 30 17:19:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr40Arg' physical association physical association mint sf5b