UniProt UniProt http://www.uniprot.org Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. J. Biol. Chem. (0021-9258) 2011 imex curation Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro competition binding competition binding tag visualisation tag visualisation Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com Accepted 2011-MAY-09 by BREUZA 06-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard Only protein-protein interactions imex curation Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. J. Biol. Chem. (0021-9258) 2011 imex curation Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro array technology array technology tag fluorescence tag visualisation by fluorescence tag fluorescence Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com Accepted 2011-MAY-09 by BREUZA 06-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard Only protein-protein interactions imex curation Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. J. Biol. Chem. (0021-9258) 2011 imex curation Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com Accepted 2011-MAY-09 by BREUZA 06-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard Only protein-protein interactions imex curation Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. J. Biol. Chem. (0021-9258) 2011 imex curation Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com Accepted 2011-MAY-09 by BREUZA 06-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard Only protein-protein interactions imex curation Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. J. Biol. Chem. (0021-9258) 2011 imex curation Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com Accepted 2011-MAY-09 by BREUZA 06-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard Only protein-protein interactions imex curation igfl2_human Insulin growth factor-like family member 2 IGFL2 UNQ645/PRO1275 protein protein human Homo sapiens Human MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP igfl1_human Insulin growth factor-like family member 1 IGFL1 UNQ644/PRO1274 protein protein human Homo sapiens Human MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS igfl3_human Insulin growth factor-like family member 3 IGFL3 UNQ483/PRO982 protein protein human Homo sapiens Human MRPRCCILALVCWITVFLLQCSKGTTDAPVGSGLWLCQPTPRCGNKIYNPSEQCCYDDAILSLKETRRCGSTCTFWPCFELCCPESFGPQQKFLVKLRVLGMKSQCHLSPISRSCTRNRRHVLYP igfr1_mouse IGF-like family receptor 1 Igflr1 Tmem149 Transmembrane protein 149 protein protein mouse Mus musculus Mouse MGPSWLLWTVAVAVLLLTRAASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPDHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTELCSQCSSGAAAAPAHVESPGRTHKQCRKKPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSASVLPLAVLPLLLVLLLILAVVLLSLFKRKVRSRPGSSSAFGDPSTSLHYWPCPGTLEVLESRNRGKANLLQLSSWELQGLASQPLSLLLDELEVLEELIMLLDPEPGPSGSTAYGTTRHLAARYGLPATWSTFAYSLRPSRSPLRALIEMVVAREPSATLGQFGTYLAQLGRTDALQVLSKLG igfr1_human IGF-like family receptor 1 TMEM149 Transmembrane protein 149 IGFLR1 U2AF1L4 U2 small nuclear RNA auxiliary factor 1-like 4 protein protein human Homo sapiens Human MGPGRCLLTALLLLALAPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLPLVVLVLLLTLAVIAILLFILLWHLCWPKEKADPYPYPGLVCGVPNTHTPSSSHLSSPGALETGDTWKEASLLPLLSRELSSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAYSLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA igfl_mouse Insulin growth factor-like family member mIgfl Igfl Gm580 Igfl3 protein protein mouse Mus musculus Mouse MKIRNACAVLIEVLLFILEGVTGARKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP igfl-igfl-2 5 11 unspecified role unspecified role neutral component neutral component flag_tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association fig 1 igfl1-igfl1-1 5 7 unspecified role unspecified role neutral component neutral component flag_tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association fig 1 igfl1-tm149 2 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fc-igg region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association fig3a tmem149-igfl1 2 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association fig3b igfl1-tmem149-2 3 7 unspecified role unspecified role unspecified role unspecified role n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization fig 4 igfl1-tmem149-1 1 7 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association fig 4c tm149-igfl1-1 4 10 unspecified role unspecified role bait bait fc-igg region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association fig 4c tm149-igfl2 4 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role bait bait fc-igg region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 4E Low response and fast dissociation tm149-igfl3 4 10 unspecified role unspecified role bait bait fc-igg region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fc-igg fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 4E tm149-igfl-1 4 11 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 5 igfl-tmem149-1 1 11 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 9 unspecified role unspecified role neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association fig 5 igfl-tmem149-2 3 11 unspecified role unspecified role unspecified role unspecified role n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 9 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization 5