IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. Cancer Cell (1535-6108) 2011 imex curation Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). Interactions involving myc-alpha-PIX, [35S]-aPIX, [35S]-bPIX , HA-PAK3, and Myc-PAK1 cannot be included, as no species info is available. mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. Cancer Cell (1535-6108) 2011 imex curation Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). Interactions involving myc-alpha-PIX, [35S]-aPIX, [35S]-bPIX , HA-PAK3, and Myc-PAK1 cannot be included, as no species info is available. mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-cl1-5 Human CL1-5 Non small cell lung carcinoma cell line cl-1-5 Human CL1-5 Non small cell lung carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. Cancer Cell (1535-6108) 2011 imex curation Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). Interactions involving myc-alpha-PIX, [35S]-aPIX, [35S]-bPIX , HA-PAK3, and Myc-PAK1 cannot be included, as no species info is available. mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-ags Homo sapiens caucasian gastric adenocarcinoma cell line AGS ags Human caucasian gastric adenocarcinoma cell line AGS Derived from an adenocarcinoma of the stomach of a 54 year old Caucasian female with no prior anti-cancer treatment. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. Cancer Cell (1535-6108) 2011 imex curation Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). Interactions involving myc-alpha-PIX, [35S]-aPIX, [35S]-bPIX , HA-PAK3, and Myc-PAK1 cannot be included, as no species info is available. mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-cl1-0 Human CL 1.0 - Non small cell lung carcinoma cell line cl1-0 CL 1-0 human non small cell lung carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. N-α-Acetyltransferase 10 Protein Suppresses Cancer Cell Metastasis by Binding PIX Proteins and Inhibiting Cdc42/Rac1 Activity. Cancer Cell (1535-6108) 2011 imex curation Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). Interactions involving myc-alpha-PIX, [35S]-aPIX, [35S]-bPIX , HA-PAK3, and Myc-PAK1 cannot be included, as no species info is available. mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hua KT., Tan CT., Johansson G., Lee JM., Yang PW., Lu HY., Chen CK., Su JL., Chen PB., Wu YL., Chi CC., Kao HJ., Shih HJ., Chen MW., Chien MH., Chen PS., Lee WJ., Cheng TY., Rosenberger G., Chai CY., Yang CJ., Huang MS., Lai TC., Chou TY., Hsiao M., Kuo ML. Cancer - Interactions investigated in the context of cancer I have spent ages trying to find species of constructs stated in data-processing below- without any way of confirming that the constructs were used in this paper - so have stopped as there are better, more productive ways to spend my time.... The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). The authors have confirmed all Naa10p constructs used are human in origin, and HA-alphaPIX is human, (Rosenberger G. -2007), HA-betaPIX is Rat (Manser E. Mol Cell 1998) and Myc-beta PIX is Human (Bagrodia S -JBC 1998). mhsiao@gate.sinica.edu.tw, kuominliang@ntu.edu.tw Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation git2_human ARF GTPase-activating protein GIT2 G protein-coupled receptor kinase-interactor 2 GRK-interacting protein 2 Cool-interacting tyrosine-phosphorylated protein 2 GIT2 KIAA0148 protein protein human Homo sapiens Human MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPDHKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRAAQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPGDPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN 07EFE266DB2F3258 naa10_human N-alpha-acetyltransferase 10 ARD1 NAA10 TE2 NatA catalytic subunit Naa10 ARD1A N-terminal acetyltransferase complex ARD1 subunit homolog A protein protein human Homo sapiens Human MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 6393A907F5C2DDC4 arhg7_human Rho guanine nucleotide exchange factor 7 PAK-interacting exchange factor beta Beta-Pix COOL-1 p85 Nbla10314 ARHGEF7 COOL1 KIAA0142 P85SPR PAK3BP PIXB protein protein human Homo sapiens Human MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN DIP protein Q14155 original sequence version: 163 DIP protein Q14155 original sequence version: 159 613EBA839E6FDBFD git1_human ARF GTPase-activating protein GIT1 GIT1 G protein-coupled receptor kinase-interactor 1 GRK-interacting protein 1 Cool-associated and tyrosine-phosphorylated protein 1 p95-APP1 protein protein human Homo sapiens Human MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQTLQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPDHKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSLSSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ 702744942A796399 arhg7_mouse Rho guanine nucleotide exchange factor 7 PAK-interacting exchange factor beta Beta-Pix p85SPR Arhgef7 Pak3bp Kiaa0142 protein protein mouse Mus musculus Mouse MNSAEQTVTWLITLGVLESPKKTISDPEVFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRNESECLSNIREFLRACGASLRLETFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSSHSRTSKLLQSQYRSLDMTDNTNSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETEHEYSKELQSVLSTYLRPLQTSDKLSSANTSYLMGNLEEISSFQQVLVQSLEECTKSPEAQQRVGGCFLSLMPQMRTLYLAYCANHPSAVSVLTEHSEDLGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQILTEPIRSWEGDDIKTLGSVTYMSQVTIQCAGSEEKNERYLLLFPNLLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCTSQQDLHEWVEHLQKQTKVTSVSNPTIKPHSVPSHTLPSHPLTPSSKHADSKPVALTPAYHTLPHPSHHGTPHTTISWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASRSRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL 46D61B606B8391B4 git1_rat ARF GTPase-activating protein GIT1 Git1 Cool-associated and tyrosine-phosphorylated protein 1 G protein-coupled receptor kinase-interactor 1 GRK-interacting protein 1 GRK-interactor 1 protein protein rat Rattus norvegicus (Rat) Rat MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQTLQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPDHKNGHYIIPQMADRSRQKCMSQSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSLSSPTDNLELSARNQSDLDDQHDYDSVASDEDTDQEPLPSAGATRNNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRKLQREIHKLQAENLQLRQPPGPVPVPSLPSERAEHTLMGPGGSTHRRDRQAFSMYEPGSALKPFGGAPGDELATRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASSVTFTPSSPLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKEDELHAELESLDGDPDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ 797C8EB7FCB3F481 arhg7_rat Rho guanine nucleotide exchange factor 7 Arhgef7 Pak3bp Pixb Beta-Pix PAK-interacting exchange factor beta protein protein rat Rattus norvegicus (Rat) Rat MTDNANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETEHEYSKELQSVLSTYLWPLQTSEKLSSANTSYLMGNLEEISSFQQVLVQSLEECTKSPEAQQRVGGCFLSLMPQMRTLYLAYCANHPSAVSVLTEHSEDLGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQILTEPIRSWEGDDIKTLGSVTYMSQVTIQCAGSEEKNERYLLLFPNLLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLHEWVEHLQRQTKVTSVSNPTIKPHSVPSHTLPSHPLTPSSKHADSKPVALTPAYHTLPHPSHHGTPHTTISWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSRSPKTMKKLLPKRKPERKPSDEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL DIP protein O55043 original sequence version: 116 17CDE7DD96ADEA53 arhg6_human Rho guanine nucleotide exchange factor 6 ARHGEF6 COOL2 KIAA0006 PIXA Rac/Cdc42 guanine nucleotide exchange factor 6 PAK-interacting exchange factor alpha Alpha-Pix COOL-2 protein protein human Homo sapiens Human MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCGRSSSLSAANTSQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEVTSLLGNFEEVCTFQQTLCQALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQGASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQDLRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEETRSNGQTIMEEKSLVDTVYALKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSSKTSILP DIP protein Q15052 original sequence version: 165 5D2622314E46341B naa10-arhg7 1 7 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 5A n-terminal location of tags found from Data-processing refs - not any given in this paper for Naa10p-V5. naa10-arhgef7 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig 5B arhgef7-git1 5 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig 6D, S6C. The ability of GST-βPIX to associate with Flag-tagged GIT1 and GIT2 was decreased in the presence of V5-tagged Naa10p (Figure 6D) or Naa10p-R82A (Figure S6C). arhgef7-git2-6 5 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig 6D, S6C. The ability of GST-βPIX to associate with Flag-tagged GIT1 and GIT2 was decreased in the presence of V5-tagged Naa10p (Figure 6D) or Naa10p-R82A (Figure S6C). arhgef7-git1 4 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig 6E arhgef7-git1-1 2 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig 6E naa10-arhgef7-2 1 7 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S5A n-terminal location of tags found from Data-processing refs - not any given in this paper for Naa10p-V5. naa10-arhg7-3 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig 5E naa10-arhg7-4 1 12 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5F n-terminal location of tags found from Data-processing refs - not any given in this paper for Naa10p-V5. all constructs with a GIT-binding domain (GBD) interacted with Naa10p (Figure 5F) and Naa10p and αPIX interacted in the same fashion (Figure S5D). naa10-arhgef6-1 1 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined git_binding_domain required to bind necessary binding region required to bind range range range range 7 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S5D n-terminal location of tags found from Data-processing refs - not any given in this paper for Naa10p-V5. all constructs with a GIT-binding domain (GBD) interacted with Naa10p, and Naa10p and αPIX interacted in the same fashion. SH3 and LZ domain deletion also seems to affect the interaction between αPIX and Naa10p. naa10-arhgef6-2 5 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association S6E GST-Naa10p lost its ability to associate with Myc-tagged αPIX in the presence of Flag-tagged GIT1 (Figure S6E). arhgef7-naa10 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig 5B. naa10-arhgef6-3 1 13 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5A n-terminal location of tags found from Data-processing refs - not any given in this paper for Naa10p-V5. arhgef7-git2-7 5 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 6D The ability of GST-βPIX to associate with Flag-tagged GIT1 and GIT2 was decreased in the presence of V5-tagged Naa10p (Figure 6D) or Naa10p-R82A (Figure S6C). arhgef7-git1-2 5 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 6D The ability of GST-βPIX to associate with Flag-tagged GIT1 and GIT2 was decreased in the presence of V5-tagged Naa10p (Figure 6D) or Naa10p-R82A (Figure S6C).