IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oncometabolite 2-Hydroxyglutarate Is a Competitive Inhibitor of α-Ketoglutarate-Dependent Dioxygenases. Oncometabolite 2-Hydroxyglutarate Is a Competitive Inhibitor of α-Ketoglutarate-Dependent Dioxygenases. Cancer Cell (1535-6108) 2011 imex curation Xu W., Yang H., Liu Y., Yang Y., Wang P., Kim SH., Ito S., Yang C., Wang P., Xiao MT., Liu LX., Jiang WQ., Liu J., Zhang JY., Wang B., Frye S., Zhang Y., Xu YH., Lei QY., Guan KL., Zhao SM., Xiong Y. 2-HYDROXYPENTANEDIOIC ACID is the IUPAC name for 2-hydroxyglutaric acid kuguan@ucsd.edu, zhaosm@fudan.edu.cn, yxiong@email.unc.edu. orchard Only protein-protein interactions in vitro In vitro demethylase assay demethylase assay sequence tag sequence tag identification sequence tag Xu W., Yang H., Liu Y., Yang Y., Wang P., Kim SH., Ito S., Yang C., Wang P., Xiao MT., Liu LX., Jiang WQ., Liu J., Zhang JY., Wang B., Frye S., Zhang Y., Xu YH., Lei QY., Guan KL., Zhao SM., Xiong Y. 2-HYDROXYPENTANEDIOIC ACID is the IUPAC name for 2-hydroxyglutaric acid kuguan@ucsd.edu, zhaosm@fudan.edu.cn, yxiong@email.unc.edu. Accepted 2011-MAR-24 by ORCHARD Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation Oncometabolite 2-Hydroxyglutarate Is a Competitive Inhibitor of α-Ketoglutarate-Dependent Dioxygenases. Oncometabolite 2-Hydroxyglutarate Is a Competitive Inhibitor of α-Ketoglutarate-Dependent Dioxygenases. Cancer Cell (1535-6108) 2011 imex curation Xu W., Yang H., Liu Y., Yang Y., Wang P., Kim SH., Ito S., Yang C., Wang P., Xiao MT., Liu LX., Jiang WQ., Liu J., Zhang JY., Wang B., Frye S., Zhang Y., Xu YH., Lei QY., Guan KL., Zhao SM., Xiong Y. 2-HYDROXYPENTANEDIOIC ACID is the IUPAC name for 2-hydroxyglutaric acid kuguan@ucsd.edu, zhaosm@fudan.edu.cn, yxiong@email.unc.edu. orchard Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu W., Yang H., Liu Y., Yang Y., Wang P., Kim SH., Ito S., Yang C., Wang P., Xiao MT., Liu LX., Jiang WQ., Liu J., Zhang JY., Wang B., Frye S., Zhang Y., Xu YH., Lei QY., Guan KL., Zhao SM., Xiong Y. 2-HYDROXYPENTANEDIOIC ACID is the IUPAC name for 2-hydroxyglutaric acid kuguan@ucsd.edu, zhaosm@fudan.edu.cn, yxiong@email.unc.edu. Accepted 2011-MAR-24 by ORCHARD Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation kdm7_caeel Lysine-specific demethylase 7 homolog jmjd-1.2 JmjC domain-containing protein 1.2 PHD finger protein 8 homolog PHF8 homolog F29B9.2 protein protein caeel Caenorhabditis elegans MDGNDINIQKNEFSRDQSALLMMDQHSDHKNHESAIGEPGMSYTASQPALSSTEHQTPLVSEASVAAPQNHLNGNSHESVSEMDRNSVDFAIESVLMKARAYNKMGAPKDPRRKQHNPKSEPKIEPHVTDSSDNQAAMSNKMEAEAPKMESNQNYVSNGSEPPFRFVSISNFDEMKTKKKEVQEELKLEVDSDSEEDDVPEQKTPKESDRCGGCGKFTHEDDLIALEEEKKKEKEKPLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVSGAEYIKLLQREEYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNKPMGLKQKRKSRESAERDDEDYCPSSSTAYKKKYTKKAKKDNDDAPKVKKAKKEEVPEEKVPVPEAAGPSEVTAPLTIKIGMGPTEDQKGVVQIFNNQCTSSGRKVKLNQNVADYCGSHLEARVEEIPEKATKSFRELDNELERCEAVHSGEKIKKVKEPKPPKQPKEKKEKPPPKKKEMSSRDRLMKKLKM 8AE17DC5860EDFA5 h3_caeel Histone H3 his-2 his-6 his-9 his-13 his-17 his-25 his-27 his-32 his-42 his-45 his-49 his-55 his-59 his-63 T10C6.13 F45F2.13 ZK131.3 ZK131.7 K06C4.5 ZK131.2 K06C4.13 F17E9.10 F08G2.3 B0035.10 F07B7.5 F54E12.1 F55G1.2 F22B3.2 protein protein caeel Caenorhabditis elegans MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 40D7DE0EF5BA6F1F r-2-hg (R)-2-hydroxyglutaric acid OR (2R)-2-hydroxypentanedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) iron2plus iron(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q92133_xenla Histone H3 h3c8.S H3l h3c8 hist1h3g protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA DIP protein Q92133 original sequence version: 87 69B8368EA50A0EEC a-kg alpha-ketoglutarate OR 2-OXOGLUTARIC ACID small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) kdm7-q92133 1 7 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain dimethyl_lysine melys methylated lysine MeLys certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 enzyme enzyme neutral component neutral component demethylation demethylation reaction demethylation 2-hydroxyglutarate, D>Lform. Fig 1A, 1B, S1. α-ketoglutarate kdm7-q92133-1 1 4 enzyme target enzyme target substrate substrate neutral component neutral component dimethyl_lysine melys methylated lysine MeLys certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 enzyme enzyme neutral component neutral component demethylation demethylation reaction demethylation 2-hydroxyglutarate, D>Lform. Fig 1A, 1B, S1. α-ketoglutarate iron2plus-kdm7-1 2 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component jmjc_domain sufficient to bind sufficient binding region sufficient to bind range range range range asp-497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component physical association physical association Fig 2A, Table 1, Fig S2. Working R factor of 21.4%, Free R-factor: 25.05%. 2.1A. a_kg-iron2plus 2 3 unspecified role unspecified role neutral component neutral component jmjc_domain sufficient to bind sufficient binding region sufficient to bind range range range range asp-497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component physical association physical association Fig 2B, Table 1. Working R factor of 18.75%, Free R-factor: 22.36%. 2.25A. Glycerol is also listed on the pdbe page - but as far as I can see this is only a buffer component (so why was it not included for the other molecule?) = so NOT added as an interactor.