UniProt UniProt http://www.uniprot.org Proteinase-activated receptors, nucleotide P2Y receptors, and μ-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking. Proteinase-activated receptors, nucleotide P2Y receptors, and μ-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking. J. Neurochem. (0022-3042) 2011 mimix curation Luo W., Wang Y., Reiser G. Origin of constructs/proteins confirmed by author by e-mail georg.reiser@med.ovgu.de 14-Mar-2012: Contacted by JYOTI. human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Luo W., Wang Y., Reiser G. Origin of constructs/proteins confirmed by author by e-mail georg.reiser@med.ovgu.de Accepted 2011-DEC-15 by JYOTI J. Neurochem. (0022-3042) 2011 mimix curation Proteinase-activated receptors, nucleotide P2Y receptors, and μ-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking. Proteinase-activated receptors, nucleotide P2Y receptors, and μ-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking. J. Neurochem. (0022-3042) 2011 mimix curation Luo W., Wang Y., Reiser G. Origin of constructs/proteins confirmed by author by e-mail georg.reiser@med.ovgu.de 14-Mar-2012: Contacted by JYOTI. human Homo sapiens Human confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Luo W., Wang Y., Reiser G. Origin of constructs/proteins confirmed by author by e-mail georg.reiser@med.ovgu.de Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Neurochem. (0022-3042) 2011 mimix curation Proteinase-activated receptors, nucleotide P2Y receptors, and μ-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking. Proteinase-activated receptors, nucleotide P2Y receptors, and μ-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking. J. Neurochem. (0022-3042) 2011 mimix curation Luo W., Wang Y., Reiser G. Origin of constructs/proteins confirmed by author by e-mail georg.reiser@med.ovgu.de 14-Mar-2012: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Luo W., Wang Y., Reiser G. Origin of constructs/proteins confirmed by author by e-mail georg.reiser@med.ovgu.de Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Neurochem. (0022-3042) 2011 mimix curation tmed2_human Transmembrane emp24 domain-containing protein 2 TMED2 RNP24 Membrane protein p24A p24 family protein beta-1 p24 protein protein human Homo sapiens Human MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV C452370E459DC894 tmeda_human Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmp-21-I p24delta S31III125 TMED10 TMP21 p23 p24 family protein delta-1 S31I125 protein protein human Homo sapiens Human MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE 0A0486BE65C4DBBB p2y11_human P2Y purinoceptor 11 P2RY11 protein protein human Homo sapiens Human MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ C02DF9B3B381D25E p2ry4_human P2Y purinoceptor 4 P2RY4 NRU P2P Uridine nucleotide receptor protein protein human Homo sapiens Human MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLFIFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLYCSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKGTTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSRLRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL 23E0AFED3B7BDEED par2_human Proteinase-activated receptor 2 F2RL1 GPR11 PAR2 Coagulation factor II receptor-like 1 G-protein coupled receptor 11 Thrombin receptor-like 1 protein protein human Homo sapiens Human MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY DIP protein P55085 original sequence version: 142 F1A4E1D5AB9B362B p33535-4 Mu-type opioid receptor MOR1B Oprm1 Ror-b Opioid receptor B protein protein rat Rattus norvegicus (Rat) Rat MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSTRVRQNTREHPSTANTVDRTNHQKIVLF 81767FCF38618035 par1_human Proteinase-activated receptor 1 CF2R PAR1 TR Coagulation factor II receptor Thrombin receptor F2R protein protein human Homo sapiens Human MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIYKKLLT DIP protein P25116 original sequence version: 159 DIP protein P25116 original sequence version: 161 DIP protein P25116 original sequence version: 93 41B742A99EEC96AB f2r-tmed2 1 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1a p2ry4-tmed2 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1b and 4 p2ry11-tmed2 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1c and 3 oprm1-oprm1 1 9 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 1d f2rl1-tmed2-5 3 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 2a f2rl1-tmed10 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 5a f2rl1-tmed10-1 2 5 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 5b oprm1-oprm1-1 2 9 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 6a