IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A two-hybrid assay to study protein interactions within the secretory pathway. A two-hybrid assay to study protein interactions within the secretory pathway. PLoS ONE (null) 2010 imex curation Dube D.H., Li B., Greenblatt E.J., Nimer S., Raymond A.K., Kohler J.J. Golgi 2-H method capitalizes on the modular nature of Golgi-resident glycosyltransferases, which consist of localization (LOC) and catalytic (CAT) domains.In the G2H system, the interaction between two proteins reconstitutes the glycosyltransferase in a null background, thereby restoring wild-type cell surface glycosylation, essential for growth or resistance to stress. The G2H reporter in this assay is the yeast glycosyltransferase Och1p Jennifer.Kohler@UTSouthwestern.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast complementation protein complementation assay PCA complementation predetermined predetermined participant predetermined Dube D.H., Li B., Greenblatt E.J., Nimer S., Raymond A.K., Kohler J.J. Golgi 2-H method capitalizes on the modular nature of Golgi-resident glycosyltransferases, which consist of localization (LOC) and catalytic (CAT) domains.In the G2H system, the interaction between two proteins reconstitutes the glycosyltransferase in a null background, thereby restoring wild-type cell surface glycosylation, essential for growth or resistance to stress. The G2H reporter in this assay is the yeast glycosyltransferase Och1p Jennifer.Kohler@UTSouthwestern.edu Accepted 2011-OCT-10 by MGT PLoS ONE (null) 2010 Only protein-protein interactions imex curation id2_mouse DNA-binding protein inhibitor ID-2 Id2 Id-2 Idb2 Inhibitor of DNA binding 2 Inhibitor of differentiation 2 protein protein mouse Mus musculus Mouse MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG DIP protein P41136 original sequence version: 92 A0D98D54F2686CC5 gal80_yeast Galactose/lactose metabolism regulatory protein GAL80 GAL80 YM9958.12 YM9827.01 YML051W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDYNKRSSVSTVPNAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRANDFPLANGQQAPLDPGYDAGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL 1492473684F3894C 1492473684F3894C myod1_mouse Myoblast determination protein 1 Myod1 Myod protein protein mouse Mus musculus Mouse MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRLVHMGALLKPEEHAHFPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVERISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPDAAPQCPAGSNPNAIYQVL DIP protein P10085 original sequence version: 90 DIP protein P10085 original sequence version: 88 AEC6572277A78D54 med15_yeast Mediator of RNA polymerase II transcription subunit 15 YOL051W GAL11 RAR3 SPT13 ABE1 MED15 SDS4 Mediator complex subunit 15 Transcription regulatory protein GAL11 Basal expression activator protein 1 Autonomous replication regulatory protein 3 Defective silencing suppressor protein 4 Ty insertion suppressor protein 13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAAPVQDKDTLSNAERAKNVNGLLQVLMDINTLNGGSSDTADKIRIHAKNFEAALFAKSSSKKEYMDSMNEKVAVMRNTYNTRKNAVTAAAANNNIKPVEQHHINNLKNSGNSANNMNVNMNLNPQMFLNQQAQARQQVAQQLRNQQQQQQQQQQQQRRQLTPQQQQLVNQMKVAPIPKQLLQRIPNIPPNINTWQQVTALAQQKLLTPQDMEAAKEVYKIHQQLLFKARLQQQQAQAQAQANNNNNGLPQNGNINNNINIPQQQQMQPPNSSANNNPLQQQSSQNTVPNVLNQINQIFSPEEQRSLLQEAIETCKNFEKTQLGSTMTEPVKQSFIRKYINQKALRKIQALRDVKNNNNANNNGSNLQRAQNVPMNIIQQQQQQNTNNNDTIATSATPNAAAFSQQQNASSKLYQMQQQQQAQAQAQAQAQAQAQAQAQAQAAQAAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQHQPSQQPQQAQQQPNPLHGLTPTAKDVEVIKQLSLDASKTNLRLTDVTNSLSNEEKEKIKMKLKQGQKLFVQVSNFAPQVYIITKNENFLKEVFQLRIFVKEILEKCAEGIFVVKLDTVDRLIIKYQKYWESMRIQILRRQAILRQQQQMANNNGNPGTTSTGNNNNIATQQNMQQSLQQMQHLQQLKMQQQQQQQQQQQQQQQQQQQQQQQHIYPSSTPGVANYSAMANAPGNNIPYMNHKNTSSMDFLNSMENTPKVPVSAAATPSLNKTINGKVNGRTKSNTIPVTSIPSTNKKLSISNAASQQPTPRSASNTAKSTPNTNPSPLKTQTKNGTPNPNNMKTVQSPMGAQPSYNSAIIENAFRKEELLLKDLEIRKLEISSRFKHRQEIFKDSPMDLFMSTLGDCLGIKDEEMLTSCTIPKAVVDHINGSGKRKPTKAAQRARDQDSIDISIKDNKLVMKSKFNKSNRSYSIALSNVAAIFKGIGGNFKDLSTLVHSSSPSTSSNMDVGNPRKRKASVLEISPQDSIASVLSPDSNIMSDSKKIKVDSPDDPFMTKSGATTSEKQEVTNEAPFLTSGTSSEQFNVWDWNNWTSAT 275C78721B5415C7 275C78721B5415C7 hap5_yeast Transcriptional activator HAP5 YOR358W HAP5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDRNFSPQQGQGPQESLPEGPQPSTMIQREEMNMPRQYSEQQQLQENEGEGENTRLPVSEEEFRMVQELQAIQAGHDQANLPPSGRGSLEGEDNGNSDGADGEMDEDDEEYDVFRNVGQGLVGHYKEIMIRYWQELINEIESTNEPGSEHQDDFKSHSLPFARIRKVMKTDEDVKMISAEAPIIFAKACEIFITELTMRAWCVAERNKRRTLQKADIAEALQKSDMFDFLIDVVPRRPLPQ 4104058BF48A4319 4104058BF48A4319 prs10_yeast 26S proteasome subunit RPT4 RPT4 CRL13 PCS1 SUG2 26S protease subunit SUG2 Proteasomal cap subunit YOR259C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEQDPLLAGLGETSGDNHTQQSHEQQPEQPQETEEHHEEEPSRVDPEQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 0EA42A599E2B2E2A 0EA42A599E2B2E2A gal4_yeast Regulatory protein GAL4 GAL4 YPL248C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNKDAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVSIDSAAHHDNSTIPLDFMPRDALHGFDWSEEDDMSDGLPFLKTDPNNNGFFGDGSLLCILRSIGFKPENYTNSNVNRLPTMITDRYTLASRSTTSRLLQSYLNNFHPYCPIVHSPTLMMLYNNQIEIASKDQWQILFNCILAIGAWCIEGESTDIDVFYYQNAKSHLTSKVFESGSIILVTALHLLSRYTQWRQKTNTSYNFHSFSIRMAISLGLNRDLPSSFSDSSILEQRRRIWWSVYSWEIQLSLLYGRSIQLSQNTISFPSSVDDVQRTTTGPTIYHGIIETARLLQVFTKIYELDKTVTAEKSPICAKKCLMICNEIEEVSRQAPKFLQMDISTTALTNLLKEHPWLSFTRFELKWKQLSLIIYVLRDFFTNFTQKKSQLEQDQNDHQSYEVKRCSIMLSDAAQRTVMSVSSYMDNHNVTPYFAWNCSYYLFNAVLVPIKTLLSNSKSNAENNETAQLLQQINTVLMLLKKLATFKIQTCEKYIQVLEEVCAPFLLSQCAIPLPHISYNNSNGSAIKNIVGSATIAQYPTLPEENVNNISVKYVSPGSVGPSPVPLKSGASFSDLVKLLSNRPPSRNSPVTIPRSTPSHRSVTPFLGQQQQLQSLVPLTPSALFGGANFNQSGNIADSSLSFTFTNSSNGPNLITTQTNSQALSQPIASSNVHDNFMNNEITASKIDDGNNSKPLSPGWTDQTAYNAFGITTGMFNTTTMDDVYNYLFDDEDTPPNPKKE 29D7FF68B0B05880 29D7FF68B0B05880 id2-myod1 1 4 unspecified role unspecified role neutral component neutral component P10085:p.Leu150Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K Wed May 02 16:36:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu150lys' Tue Jun 30 17:09:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu150Lys' loc tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P10085:p.Ile149Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I K Wed May 02 16:06:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile149lys' Tue Jun 30 17:50:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile149Lys' P10085:p.Ile157Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I K Wed May 02 17:12:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile157lys' Tue Jun 30 15:35:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile157Lys' P10085:p.Leu160Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L K Wed May 02 15:46:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu160lys' Tue Jun 30 16:13:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu160Lys' P10085:p.Gln161Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q K Wed May 02 16:31:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln161lys' Tue Jun 30 15:54:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln161Lys' 2 unspecified role unspecified role neutral component neutral component cat tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P41136:p.Val86Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V K Wed May 02 16:25:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val86lys' Tue Jun 30 19:12:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val86Lys' P41136:p.Leu124Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L K Wed May 02 15:52:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu124lys' Tue Jun 30 17:11:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu124Lys' physical association physical association Figs. 3A, 4A, 4C, 5 There is a discrepancy between the given sequence length (137aa) of ID2 and that in UniProt (134aa) which could not be reconciled. gal4-gal80 1 8 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cat tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component loc tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5A gal11-gal4 1 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain loc tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component cat tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 34 30 physical association physical association Fig. 5A gal4-hap5 1 6 unspecified role unspecified role neutral component neutral component loc tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cat tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5A gal4-rpt4 1 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component cat tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5A