UniProt UniProt http://www.uniprot.org Arabidopsis MKS1 is involved in basal immunity and requires an intact N-terminal domain for proper function. Arabidopsis MKS1 is involved in basal immunity and requires an intact N-terminal domain for proper function. PLoS ONE (null) 2010 imex curation Petersen K., Qiu J.L., Lutje J., Fiil B.K., Hansen S., Mundy J., Petersen M. shutko@bio.ku.dk 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Petersen K., Qiu J.L., Lutje J., Fiil B.K., Hansen S., Mundy J., Petersen M. shutko@bio.ku.dk Accepted 2011-SEP-22 by ORCHARD PLoS ONE (null) 2010 Only protein-protein interactions imex curation mks1_arath Protein MKS1 MKS1 Protein MAP kinase 4 substrate 1 VQ motif-containing protein 21 VQ21 MVE11.5 At3g18690 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPSEYFAGGNPSDQQNQKRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPNRDQPPPYIPREPVVIYAVSPKVVHATASEFMNVVQRLTGISSGVFLESGGGGDVSPAARLASTENASPRGGKEPAARDETVEINTAMEEAAEFGGYAPGILSPSPALLPTASTGIFSPMYHQGGMFSPAIPLGLFSPAGFMSPFRSPGFTSLVASPTFADFFSHIWDQD 54CB8449CD5AC2B5 wrk25_arath Probable WRKY transcription factor 25 WRKY25 At2g30250 T9D9.6 WRKY DNA-binding protein 25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSTSFTDLLGSSGVDCYEDDEDLRVSGSSFGGYYPERTGSGLPKFKTAQPPPLPISQSSHNFTFSDYLDSPLLLSSSHSLISPTTGTFPLQGFNGTTNNHSDFPWQLQSQPSNASSALQETYGVQDHEKKQEMIPNEIATQNNNQSFGTERQIKIPAYMVSRNSNDGYGWRKYGQKQVKKSENPRSYFKCTYPDCVSKKIVETASDGQITEIIYKGGHNHPKPEFTKRPSQSSLPSSVNGRRLFNPASVVSEPHDQSENSSISFDYSDLEQKSFKSEYGEIDEEEEQPEMKRMKREGEDEGMSIEVSKGVKEPRVVVQTISDIDVLIDGFRWRKYGQKVVKGNTNPRSYYKCTFQGCGVKKQVERSAADERAVLTTYEGRHNHDIPTALRRS 9057D65B69E12A0C wrk33_arath Probable WRKY transcription factor 33 WRKY33 At2g38470 T19C21.4 WRKY DNA-binding protein 33 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASFLTMDNSRTRQNMNGSANWSQQSGRTSTSSLEDLEIPKFRSFAPSSISISPSLVSPSTCFSPSLFLDSPAFVSSSANVLASPTTGALITNVTNQKGINEGDKSNNNNFNLFDFSFHTQSSGVSAPTTTTTTTTTTTTTNSSIFQSQEQQKKNQSEQWSQTETRPNNQAVSYNGREQRKGEDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLEGQITEIVYKGSHNHPKPQSTRRSSSSSSTFHSAVYNASLDHNRQASSDQPNSNNSFHQSDSFGMQQEDNTTSDSVGDDEFEQGSSIVSRDEEDCGSEPEAKRWKGDNETNGGNGGGSKTVREPRIVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDMRAVITTYEGKHNHDVPAARGSGYATNRAPQDSSSVPIRPAAIAGHSNYTTSSQAPYTLQMLHNNNTNTGPFGYAMNNNNNNSNLQTQQNFVGGGFSRAKEEPNEETSFFDSFMP A90A6A8A2DF56DB1 mpk4_arath Mitogen-activated protein kinase 4 MPK4 At4g01370 F2N1.1 F2N1_2-t protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAESCFGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKFNPQDSV 448F65C25C95AAEB mks1-mpk4 1 2 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association Fig.4, Table 1 mks1-wrk33 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig.4, Table 1 mks1-wrk25 1 2 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association Fig.4, Table 1 mpk4-mks1 1 5 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey Q8LGD5:p.Leu32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:48:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu32ala' Tue Jun 30 18:06:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu32Ala' Q8LGD5:p.Ser38Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:58:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser38ala' Tue Jun 30 17:39:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser38Ala' Q8LGD5:p.Lys40Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:55:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40ala' Tue Jun 30 16:21:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys40Ala' Q8LGD5:p.Pro29Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A Wed May 02 14:28:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro29ala' Tue Jun 30 19:58:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro29Ala' Q8LGD5:p.Lys19Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:12:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys19ala' Tue Jun 30 17:33:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys19Ala' Q8LGD5:p.Arg28Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:47:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg28ala' Tue Jun 30 17:47:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg28Ala' physical association physical association Fig. 5A, 5B