IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Mol. Biol. Cell (1059-1524) 2011 imex curation Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tmc.edu 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Accepted 2011-AUG-15 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2011 orchard Only protein-protein interactions imex curation Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Mol. Biol. Cell (1059-1524) 2011 imex curation Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tmc.edu 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Accepted 2011-AUG-15 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2011 orchard Only protein-protein interactions imex curation Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Mol. Biol. Cell (1059-1524) 2011 imex curation Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tmc.edu 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Accepted 2011-AUG-15 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2011 orchard Only protein-protein interactions imex curation Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. Mol. Biol. Cell (1059-1524) 2011 imex curation Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tmc.edu 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Accepted 2011-AUG-15 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2011 orchard Only protein-protein interactions imex curation 1-phosphatidyl-1d-myo-inositol 4-phosphate 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9gyj9_caeel snx-1 CELE_C05D9.1 C05D9.1 protein protein caeel Caenorhabditis elegans MLSEEDVHTNSYAGRTVAVMEQPDLFSDDCDEINLGNEDTPPSKLRLHTTEEPKESSSPAVINSIEDHDQYVGNDNHYAQISPEPALSNFKVTMREFEKRGDGMNAYIVYKLETEVSGVVGYTKQHYETWRRFSDFLGLHGKIVEKYLAKGIVIPQPPEKSISALTKTKTNSDPAMSREVGIQRARQLERYICRLIQHPRMRNDCDVRDFLTIESDLPKAVQTAALSSFGVKKIFKNFQVVFSKMAFHMEEGDRWFEQVQSQVDELDEALRKLYTVTETLVASRRDMATSGEQLGKALSMLAACEESTSLSRALSSLTDVTENVSAVYGKQAEVDNSKFSESIYEYIMLISALKDVFGERVRAWQQWQDAQQTLARKRDQKTKIDLSAGGRNERSDQLKGEIEDTVQKMDQLEQHFIELSKAIREEVARFDADRKQDMKKMLVEYMESMIHTHTELLHLWEKFEPEANNIRV BFFB40F307F2AF60 pi3p 1-phosphatidyl-1D-myo-inositol 3-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dyn1_caeel Dynamin dyn-1 C02C6.1 protein protein caeel Caenorhabditis elegans MSWQNQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQVIRKGWLSLSNVSFVRGSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGKNIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGGMYPPLIPTRPGPGGPPPNMAPPR FF681250E51AB8A5 1-phosphatidyl-1d-myo-inositol 3,4,5-trisphosphate 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pi5p 1-phosphatidyl-1D-myo-inositol 5-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lst4_caeel Sorting nexin lst-4 lst-4 Lateral signaling target protein 4 Y37A1B.2 protein protein caeel Caenorhabditis elegans MAQVKAEYDFQSQPNTGELSISAGEVLTVIRENIDGGWIEGRNVRGSVGLFPESYVTPYQASRPPPVLPPPLPPTSSGPPAASSRPFDDWGGASEVAAPPSYGAQHHHQPTPSVPEVTRSSYPSQNDDFDDEWTDEDDEQEPTRPNVQSSIGSNSRRDLSRSHSEHGGPDRGSNKVNKNINRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNGIIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFRDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD 77CFBE901A3E3B24 d9ptp5_caeel Y59A8B.22 snx-6 CELE_Y59A8B.22 protein protein caeel Caenorhabditis elegans MLGDGEEVFANPLQEASSDDVTSPPAAAADVEVSLNDDDDVTTTTTNDDTFRTARSTLNDSQNTTVVQEEKKKAEKEESYSSLADNRNHRTEEINIDMNSDEAICVDISDALSEREKVKYTVHTRTRLQEMKPETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEVLLSGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNKSLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKNREIPKAEAEQSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISLLRDVVERLKSSQ AF59594B11382DC4 dyn_1-lst_4-1 4 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 5a dyn_1-lst_4-2 1 8 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 5b 1_phosphatid-lst_4-1 3 5 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction S7b and S7c 1_phosphatidyl-lst_4 3 12 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction S7b and S7c 1_phosphatid-lst_4-2 3 12 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction S7b and S7c 1_phosphatid-lst_4-3 3 12 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction S7b and S7c 1_phosphatid-snx_1-1 3 5 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction S7d and S7e 1_phosphatid-snx_1-2 3 6 unspecified role unspecified role prey prey purified purified px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction S7d and S7e 1_phosphatid-snx_1-3 3 6 unspecified role unspecified role prey prey purified purified px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction S7d and S7e 1_phosphatid-snx_1-4 3 6 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction S7d and S7e 1_phosphatid-snx_1-5 3 10 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction S7d and S7e lst_4-lst_4 4 12 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 7a snx_6-snx_1 4 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 7a snx_1-snx_1 4 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 7a snx_6-snx_6 4 13 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 7a snx_1-snx_6 2 6 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 13 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 7B snx_1-snx_6-1 4 13 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 7a