IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. Cell (0092-8674) 2010 imex curation Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Accepted 2011-JAN-14 by MGT 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. Cell (0092-8674) 2010 imex curation Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions drome-ovary Drosophila melanogaster ovary ovary Ovary anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Accepted 2011-JAN-14 by MGT 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. Cell (0092-8674) 2010 imex curation Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag immunost anti tag immunostaining anti tag immunost Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Accepted 2011-JAN-14 by MGT 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. The Fused/Smurf complex controls the fate of Drosophila germline stem cells by generating a gradient BMP response. Cell (0092-8674) 2010 imex curation Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn 06-April-2011: Contacted by JYOTI. mgt Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag immunost anti tag immunostaining anti tag immunost Xia L., Jia S., Huang S., Wang H., Zhu Y., Mu Y., Kan L., Zheng W., Wu D., Li X., Sun Q., Meng A., Chen D. Could not do in vitro ubiquitination or interactions with vertebrate proteins. Author contacted - no response to date. Complexes from S2 cells were treated with the proteasome inhibitor MG132. Some data could not be captured as the species of origin of constructs used could not be traced. chendh@ioz.ac.cn Accepted 2011-JAN-14 by MGT 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 mgt Only protein-protein interactions imex curation q7pll3_drome eIF4B eIF-4B Dm-eIF4B Dmel\CG10837 EIF-4B Eif4B eIF-4B-L eIF-4B-S eIF-4b eIF4B-L eIF4B-S eIf4b Dmel_CG10837 CG10837 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASAGKKGKKNKGTVISLQSFLCNSDAPVGTTQVSKKIRNLDGDDSDDGSGTLPLVYQLPTAPRANRIFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAARELEIEQRLALARKQDKGRREQGLNEKLAELQVDKNDNESLSATVSWRTNQDYKESDKINKCPGEKQRDEEIHRLNHARGQFNRPELLREKPNANGESKRDCRNDRSVSKKTSQNDLVLQSSNKYSGLDNEGSE 9660314A7A7EB9F0 fused_drome Serine/threonine-protein kinase fused fu CG6551 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRYAVSSLVGQGSFGCVYKATRKDDSKVVAIKVISKRGRATKELKNLRRECDIQARLKHPHVIEMIESFESKTDLFVVTEFALMDLHRYLSYNGAMGEEPARRVTGHLVSALYYLHSNRILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHVLTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVKWPSTLTSECRSFLQGLLEKDPGLRISWTQLLCHPFVEGRIFIAETQAEAAKESPFTNPEAKVKSSKQSDPEVGDLDEALAALDFGESRQENLTTSRDSINAIAPSDVEHLETDVEDNMQRVVVPFADLSYRDLSGVRAMPMVHQPVINSHTCFVSGNSNMILNHMNDNFDFQASLRGGGVAAKPIVAPTVRQSRSKDLEKRKLSQNLDNFSVRLGHSVDHEAQRKATEIATQEKHNQENKPPAEAISYANSQPPQQQPQQLKHSMHSTNEEKLSSDNTPPCLLPGWDSCDESQSPPIENDEWLAFLNRSVQELLDGELDSLKQHNLVSIIVAPLRNSKAIPRVLKSVAQLLSLPFVLVDPVLIVDLELIRNVYVDVKLVPNLMYACKLLLSHKQLSDSAASAPLTTGSLSRTLRSIPELTVEELETACSLYELVCHLVHLQQQFLTQFCDAVAILAASDLFLNFLTHDFRQSDSDAASVRLAGCMLALMGCVLRELPENAELVERIVFNPRLNFVSLLQSRHHLLRQRSCQLLRLLARFSLRGVQRIWNGELRFALQQLSEHHSYPALRGEAAQTLDEISHFTFFVT DIP protein P23647 original sequence version: 121 DIP protein P23647 original sequence version: 147 A7804E2749B79D0C q9vg78_drome pps Dmel\CG6525 FBgn0082831 SPP Spp spp Dmel_CG6525 PPS CG6525 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSSVFTEAPSARPAAAEADSNLVVVYSKSGISFDERAIGNIMEEKSISTISVVRITSPTPSMVDQEEDERLEELANFMETATDSELDSDNGSQSGGDNASEMDEHDEENHNTGDDNNSDSTETEADAPRTRKRVGRKPKAIKKRKRRKPKERPQIVGLRVEQFYADNTADMVVKNALKLAGVSVYKRTAETDALMEVIRNDHNYTPFTSPEQLKNHKRDEKMAMEMQAQSRKIIMQAPGSVKLINAKKRVQAIPLSPVQVKVQRLPVKPHQVQQAAQLQPKVQLIRKPIHSPLPRQKPEIIANNSVNARLRPTRAPVKVIAPPVQEYIEDDDDAQSSDSAEEENADKAYDSEEMSEESDEFQESDNDRDSDMDFDMRHSNRRNPNKRKRVRKVVRQTPSKPMKPLPPPPTTPQHFPELKKRKEVLEPKAPQIGQIIQMPATKSVPAVFALGRGLPSTSFLKIRPTHQSLPVKRPPLPTTPANSNVRRMPAVQLGRIVNSPQEVKEIIINKNMASPKGVFTNLNTLLGEDNNAATKSSPVPLRHRAVMSPSTPRSSYNQQMSPIVVPVPAQAHTPSKGFMPIGVDTAQSHKLPAQIVIETHQSSSELAAENDKQLDLINSIVQDELLKSTLVEQPVVNADEDIPKLVKMLESTAADLDPPPVSLPTNIFPAPEMQGVGNAAAADPNNIMDTANEDEITADFLQHVVGLIEEDKQFEAEVVKQVLASTEPGTLDAIVSMPTSIEPVDVPQAHTNLLPNASLTEPAQSMTSLPIACSTPSRSVAASTPPTSAKVVRGYGRVIYLPPIEAPTTRAKRRAQFPSAPGMAATSSSDAGNLSFGESSLDASINQPLNTSSLSNDSQPGSGPKRPNPREPSMARRSTAPRRSKKLDASQNNDPDASESQEDDDDPNKLWCICRQPHNNRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGIDWKCPKCVKRQEERSQPRITDMLVTRPTTQPEQRPSETKVLTTTAEIVQVAAPSAPRRTLPVVLTVASSPMRIPMAKPAKKFPTGAISHQQQQQLNFIRLGPSPGKRISETLCVVCKRPASTSSVYCGEECIRKYAQSAIQAHAATKGPLPQNAGAQSLLNNSFDAKKNKKKDLFEDVLRQADTVSKVERINVFERKSGRVITGHMAPSAHQFRKWLQENPSFEVLPSGTVQSADAEKRLLKGAPEAATSTSEPAVLGVAKKPPEGPAKLSHPQNTTVQASHQLGISSVRPLAKKDKEKTTPTVQAPTPNRIAAGKPEPVRIGIRRSLREQLLARIKEAQAAEENSGQPTTQWPTVLEVDQFVKNVELEMFNSFGRDVGAKYKAKYRSLMFNIKDRKNRTLFEKICAKQVEPRQLVRMTPEQLASQELAKWREEENRHQLDMIKKSELDLLACAQNYVVKTHKGEEVIATKVDVTLPEENVSEASSMADTKQTSLVSEPSTSTLERSTSREKAGSSKEKRHKSHKHHHRKRSRSRSNSRGRSVDKRHRRQHNEGGEQPGSGEREHRSREKQSRERDEIVPSPLPKKRDENDQSPVPKKTAEKKTEASAYNLVDQILESEKTVEQAANLGKPKPSPKPLPTLPSSLKAPEPMDNYSRYLHGLTTSSLWSGTLKMIDLADFEIVMYPVQGNCHQLGNLMPSQMDVIGRITRVNVWEYIKKLKKSPTKEVVIVNIFPASPSETYKFDLFFEYLDSRQRLGVLGVDSDQIRDFYIFPLGSGDKLPPALQTAEPVPFYEEAQRPNTLLGIIVRCLSKRPADAVPSTPSVPTPVPALSSKVAKRSRSSISYPAQSSPKRKISTHSTSSKDDEFDIDAIIKAPIAKLQKTAPKVVPQPSVPNDADEPYSPGGSDDELVPSAPQRPNDLERQVNEINKQIAAQQMEIAGLLKVEPTGSASSSNVLAAISIPANLSKILASIKDKTNLPSSADDGDEEYNPEDDITATSSFASKKPRSKGRLAHLSEAELLSMVPDNLAGVIPRSSRTRHQLAQSPLTPTPLPPPPPPPGV FB61A332EA710F5E smuf1_drome E3 ubiquitin-protein ligase Smurf1 Smurf HECT-type E3 ubiquitin transferase Smurf1 Lethal with a checkpoint kinase protein SMAD ubiquitination regulatory factor 1 homolog Smurf1 lack CG4943 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNKLDYPRRNGTHKVRITILCARNLARKDLFRLPDPFAKVQVDGTGQVYSTEISKSSLDPKWNAHYDLFLGIGDAITITVWNQRKIHKGSGFLGCVRIPAFNIQSLKGAGFQRLDLGKLSPDDDELVRGQIIISLLSKDGPSSGNPLAIVGPSGDVRGPSEDDSSEDSLPEGWEERRTDNGRVYYVNHATKSTQWDRPRQPGVVGSSHATSPQQRHNTHNGNSGDRQAPAGPTRSTTCTNLMNNGHRSRDLSVTASDERRHSTEILSSVGKENTSPTTPVSATTTPGKKTSSSNSSSAGGRTLEQRPTNEPATPTSSTTSASVRLHSNDNHVKTPKHQTNGHAPPESTPTSPTGQQNYVNGNAQNGSTSGNGSGQAAQPQSASNGWTQEDAATTTSPSTTTSPPRHSQSPPTPNISPPASVTPSANGNVHSPNANSTPAGSGGGSRSYTAATPGQRSQRRSSRQQGEESSTRRRSSRGTRNGGTSGGGGGGGSGQRYASAAIAAANQAARPFLDLPPGYEMRTTQQGQVYFYHIPTGVSTWHDPRIPRDFDTQHLTLDAIGPLPSGWEQRKTASGRVYFVDHNNRTTQFTDPRLSGSILQMIRRGTVPPTSAANAGTPAPPSATPATPSAAAAVPPQATPASNATPTTLTTTTNPPHRIVPDLPQGLLEGADLLPKYRRDLVGKLRALRTELQTMQPQSGHCRLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWMLESNISGIIESTFSVENNSFGALVVHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLKHCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGFAVE 6BBCC550F5129163 q95si0_drome Receptor protein serine/threonine kinase tkv Atkv Atr25D Brk25D Brk25D1 Brk25D2 Dmel\CG14026 Dtfr STK-A TKV TKV1 Tkv dtfr kv l(2)04415 l(2)25Da str tkv1 tkva Dmel_CG14026 CG14026 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAPKSRKKKAHARSLTCYCDGSCPDNVSNGTCETRPGGSCFSAVQQLYDETTGMYEEERTYGCMPPEDNGGFLMCKVAAVPHLHGKNIVCCDKEDFCNRDLYPTYTPKLTTPAPDLPVSSESLHTLAVFGSIIISLSVFMLIVASLCFTYKRREKLRKQPRLINSMCNSQLSPLSQLVEQSSGSGSGLPLLVQRTIAKQIQMVRLVGKGRYGEVWLAKWRDERVAVKTFFTTEEASWFRETEIYQTVLMRHDNILGFIAADIKGNGSWTQMLLITDYHEMGSLHDYLSMSVINPQKLQLLAFSLASGLAHLHDEIFGTPGKPAIAHRDIKSKNILVKRNGQCAIADFGLAVKYNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPKQFEEFKRADMYSVGLVLWEMTRRCYTPVSGTKTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGFRPPIPSRWQEDDVLATVSKIMQECWHPNPTVRLTALRVKKTLGRLETDCLIDVPIKIV D32B975584CCB15A tkv-fu-1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association alpha-tubulin and actin were also identified but could not be assigned to a single gene product. Fig. 2A fu-tkv 4 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 2B, 2G Reciprocal immunoprecipitation experiments showed that Fu and Tkv could be coimmunoprecipitated with each other in transfected S2 cells tkv-fu-3 4 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain greater-than greater-than 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined kinase region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain physical association physical association Figs. 2C, 2F, Supp. Fig. 2C Reciprocal immunoprecipitation experiments showed that Fu and Tkv could be coimmunoprecipitated with each other in transfected S2 cells Domain mapping of Tkv showed that the fragment lacking extracellular and transmembrane regions exhibited the strongest binding activity to Fu , although all of the truncation mutants of Tkv interacted with Fu. Exact coordinates of deletion mutants are not supplied in the publication tkv-smurf-1 4 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 4A As shown in Figures S4A and S4B, Smurf and Tkv coimmunoprecipitated with each other. smurf-tkv 4 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 4B As shown in Figures S4A and S4B, Smurf and Tkv coimmunoprecipitated with each other. smurf-fu-1 4 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hect region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 4A, 4F As shown in Figures 4A and 4B, Smurf and Fu coimmunoprecipitated with each other in transfected S2 cells. fu-smurf 4 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 4B As shown in Figures 4A and 4B, Smurf and Fu coimmunoprecipitated with each other in transfected S2 cells. Both the N and C terminus of Fu could coimmunoprecipitate with Smurf. fu-smurf 2 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association Figs. 4C Consistently, we found that endogenous Smurf physically associated with HA:Fu in P{uasp-HA:fu}; P{nosP-gal4:vp16} ovaries (Figure 4C). fu-smurf 3 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5B As shown in Figures 5A and 5B, after the two-step immunoprecipitations, both Flag-Tkv and HA-Smurf were present in the Myc-Fu complex, fu-lack 4 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 4G As shown in Figures 4A and 4B, Smurf and Fu coimmunoprecipitated with each other in transfected S2 cells. Both the N and C terminus of Fu could coimmunoprecipitate with Smurf.