InnateDB InnateDB Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as autoradiography autoradiography Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as antibody detection identification by antibody antibody detection Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro protein array protein array predetermined predetermined participant predetermined Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as ms participant Identification by mass spectrometry ms participant Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. Nat. Immunol. (1529-2908) 2011 imex curation Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Accepted 2011-SEP-27 by MGT 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 setd7_human Histone-lysine N-methyltransferase SETD7 SETD7 KIAA1717 SET7 KMT7 SET9 Histone H3-K4 methyltransferase SETD7 SET domain-containing protein 7 SET7/9 Lysine N-methyltransferase 7 protein protein human Homo sapiens Human MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK DIP protein Q8WTS6 original sequence version: 46 DIP protein Q8WTS6 original sequence version: 89 DIP protein Q8WTS6 original sequence version: 106 DIP protein Q8WTS6 original sequence version: 120 DIP protein Q8WTS6 original sequence version: 121 DIP protein Q8WTS6 original sequence version: 114 DIP protein Q8WTS6 original sequence version: 95 73A1217079E3BA13 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 setd6_human N-lysine methyltransferase SETD6 SETD6 SET domain-containing protein 6 protein protein human Homo sapiens Human MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLLALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS ehmt1_human Histone-lysine N-methyltransferase EHMT1 KMT1D Histone H3-K9 methyltransferase 5 Euchromatic histone-lysine N-methyltransferase 1 G9a-like protein 1 Lysine N-methyltransferase 1D EHMT1 EUHMTASE1 KIAA1876 GLP protein protein human Homo sapiens Human MAAADAEAVPARGEPQQDCCVKTELLGEETPMAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRARKTMPKSVVGLHAASKDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEEQESVDTGEEEEGGDESDLSSESSIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYMEVSLDSLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTPVPGQEKGSALEGRADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQASAAQEAQEDGLPDTSSAAAADPL 071574F3FB3D371E kpcz_human Protein kinase C zeta type PRKCZ PKC2 nPKC-zeta protein protein human Homo sapiens Human MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV 88CCD0577E6A596C rela-setd7 3 14 enzyme enzyme neutral component neutral component 13 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain methylation methylation reaction methylation Fig. S1C methylation of RelA setd6-setd6 3 16 enzyme target enzyme target substrate substrate neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 enzyme enzyme neutral component neutral component methylation methylation reaction methylation Fig. 1A (top band) methylation of SETD6 Evidence was stated in figure legend of Fig. 1A. rela-setd6-1 3 14 enzyme enzyme neutral component neutral component 13 enzyme target enzyme target substrate substrate neutral component neutral component Q04207:p.Lys310Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:12:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys310arg' Tue Jun 30 16:15:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys310Arg' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain methylation methylation reaction methylation Fig. S1C methylation of RelA rela-setd6-4 10 16 enzyme enzyme neutral component neutral component 13 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) methylation methylation reaction methylation Fig. 1C, S2A mono-methylation of RelA (Lys310me1) rela-setd6-5 6 16 enzyme enzyme neutral component neutral component Q8TBK2:p.Tyr285Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 14:54:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr285ala' Tue Jun 30 19:57:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr285Ala' 13 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q04207:p.Lys310Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:13:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys310arg' Tue Jun 30 19:05:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys310Arg' methylation methylation reaction methylation Fig. 1D mono-methylation of RelA (Lys310me1) ehmt1-rela 8 17 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 5A interaction was only detected with RelA(Lys310me1) and not detected in RelA ehmt1-rela-1 2 17 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 5B, 6B participant was detected with Ab to RelA(Lys310me1) or RelA(Lys310me2) rela-ehmt1-1 7 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range 59 57 direct interaction direct interaction Fig. 5C participant was detected with Ab to RelA(Lys310me1) or RelA(Lys310me2) interaction required the presence of SETD6 ehmt1-rela-3 4 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Fig. 5D, S8B rela-tf65 1 15 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Fig. 5E, 5F, 6C, S8C PKC-z rela-ehmt1 1 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association Fig. 5E rela-ehmt1 11 17 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Fig. 5G TNF ehmt1-rela-5 12 17 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind range range range range chemical synthesis Chemical synthesis (Chemical synthesis) 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Table 1, Fig. S18 interaction only occur when RelA is mono- or di-methylated at Lys310 pH 8.0, temp=25C prkcz-prkcz 9 18 enzyme enzyme neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined catalytic domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain phosphorylation phosphorylation reaction phosphorylation Fig. 6E phosphorylation of RelA (Ser311ph) rela-setd6-6 5 16 enzyme enzyme neutral component neutral component Q8TBK2:p.Tyr285Ala mutation mutation certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:06:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr285ala' Tue Jun 30 20:13:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr285Ala' 13 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined methylation methylation reaction methylation Fig. S2B, S6 mono-methylation of RelA (Lys310me1) setd6-rela 2 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. S8A participant was detected with Ab to RelA(Lys310me1)