IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Genome annotation and intraviral interactome for the Streptococcus pneumoniae virulent phage Dp-1. Genome annotation and intraviral interactome for the Streptococcus pneumoniae virulent phage Dp-1. J. Bacteriol. (0021-9193) 2011 imex curation Sabri M., Hauser R., Ouellette M., Liu J., Dehbi M., Moeck G., Garcia E., Titz B., Uetz P., Moineau S. 3-AT score of more than 10 was considered to be high confidence data. Only the high confidence interactions have been included in this entry. The medium and low confidence interactions were excluded since IMEx exchange can only be done with high confidence data. peter@uetz.us 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Sabri M., Hauser R., Ouellette M., Liu J., Dehbi M., Moeck G., Garcia E., Titz B., Uetz P., Moineau S. 3-AT score of more than 10 was considered to be high confidence data. Only the high confidence interactions have been included in this entry. The medium and low confidence interactions were excluded since IMEx exchange can only be done with high confidence data. peter@uetz.us Accepted 2011-JUL-07 by MGT 26-Sep-2011: Contacted by JYOTI. J. Bacteriol. (0021-9193) 2011 mgt Only protein-protein interactions imex curation e7dnd2_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MLMKVNGLQIEATPEQIIEKLSRQLEDEGTFIFRRTKSLGSNYQFSCPFHAGGTEKHPSCGMSRNPSYSGSKVTEAGTVHCFTCGYTSGLTEFVSNVLGRNDGGFYGNQWLKRNFGTSSEVVRQGVSPEAFRRNGRTEKVEHKIIPEEELDKYRFIHPYMYERKLTDELIEMFDVGYDKLHDCITFPVRNLKGETVFFNRRSVRSKFHQYGEDDPKTEFLYGQYELVAFRDYFEKPISQVFVTESVINCLTLWSMKIPAVALMGVGGGNQINLLKRLPYRNIVLALDPDNAGQTAQEKLYRQLKRSKVVRFLNYPKEFYDNKWDINDHPELLNFNDLVL 52B2091CD20F93A2 e7dn81_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MNLASKYRPQTFEEVVAQEYVKEILLNQLQNGAIKHGYLFCGGAGTGKTTTARIFAKDVNKGLGSPIEIDAASNNGVENVRNIIEDSRYKSMDSEFKVYIIDEVHMLSTGAFNALLKTLEEPSSGTVFILCTTDPQKIPDTILSRVQRFDFTRIDNDDIVNQLQFIIESENEEGAGYSYERDALSFIGKLANGGMRDSITRLEKVLDYSHHVDMEAVSNALGVPDYETFASLVEAIANYDGSKCLEIVNDFHYSGKDLKLVTRNFTDFLLEVCKYWLVRDISITQLPAHFESKLEQFCEAFQYPTLLWMLEEMNELAGVVKWEPNAKPIIETKLLLMSKEE EA07C8F6E9BA3244 e7dn65_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MSQNTTRTDAELTGVTLLGNQDTKYDYDYNPDVLETFPNKHPENNYLVTFDGYEFTSLCPKTGQPDFANVFISYIPNEKMVESKSLKLYLFSFRNHGDFHEDCMNIILNDLYELMEPKYIEVMGLFTPRGGISIYPFVNKVNPQFATPELEQLQLQRKLNFLGNVQGLGRAIR 20365681877C7FD2 hypothetical protein/znfinger domain protein protein bpdp1 Pneumococcus phage Dp-1 Similar to YP_002863284 s layer protein membranar peptidase (hypothetical protein) protein protein bpdp1 Pneumococcus phage Dp-1 e7dn68_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MVNQYNQPERGKIRINVRDPEKMPIMEIFGPTIQGEGMVIGQKTIFIRTGGCDYHCNWCDSAFTWNGTTEPEYITGKEAASRILKLAFNDKGEQICNHVTLTGGNPALINEPMAKMISILKEHGFKFGLETQGTRFQEWFKEVSDITISPKPPSSGMRTNMKILEAIVDRMNDENLDWSFKIVIFDENDLAYARDMFKTFEGKLRPVNYLSVGNANAYEEGKISDRLLEKLGWLWDKVYEDPAFNNVRPLPQLHTLVYDNKRGV 840ED89C60831520 e7dnd3_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MKEANRLVSSYVGFECWTDEECIRNFELDPDMSIASAYHRYFGMLYSYAKRFKCLSRHDIESIAFETISKCLATFKSNQGAKFSTYLTRLFKNRIVLEYRYLNAPSMNRNWYVEVTFDSVSTNEEGDDFSILSTVGYCEDYGKIEIEASLDFMTLSNTEYAYISSVIQNGPSVSDAEIAREIGVSRSAISQSKKSLKNKLKDFI B339739A0E813CB2 e7dna7_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MNIYDYINAGEIASYIQALPSNALQYLGPTLFPNAQQTGTDISWLKGANNLPVTIQPSNYDAKASLRERAGFSKQATEMAFFRESMRLGEKDRQNLQMLLNQSSALAQPLITQLYNDTKNLVDGVEAQAEYMRMQLLQYGKFTVKSTNSEAQYTYDYNMDAKQQYAVTKKWTNPAESDPIADILAAMDDIENRTGVRPTRMVLNRNTYNQMTKSDSIKKALAIGVQGSWENFLLLASDAEKFIAEKTGLQIAVYSKKIAQFADADKLPDVGNIRQFNLIDDGKVVLLPPDAVGHTWYGTTPEAFDLASGGTDAQVQVLSGGPTVTTYLEKHPVNIATVVSAVMIPSFEGIDYVGVLTTN 5644873BFB78E564 e7dnb9_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MTKFINSYGPLHLNLYVEQVSQDVTNNSSRVSWRATVDRDGAYRTWTYGNISNLSVWLNGSSVHSSHPDYDTSGEEVTLASGEVTVPHNSDGTKTMSVWASFDPNNGVHGNITISTNYTLDSIPRSTQISSFEGNRNLGSLHTVIFNRKVNSFTHQVWYRVFGSDWIDLGKNHTTSVSFTPSLDLARYLPKSSSGTMDICIRTYNGTTQIGSDVYSNGWRFNIPDSVRPTFSGISLVDTTSAVRQILTGNNFLQIMSNIQVNFNNASGAYGSTIQAFHAELVGKNQAINENGGKLGMMNFNGSATVRAWVTDTRGKQSNVQDVSINVIEYYGPSINFSVQRTRQNPAIIQALRNAKVAPITVGGQQKNIMQITFSVAPLNTTNFTEDRGSASGTFTTISLMTNSSANLAGNYGPDKSYIVKAKIQDRFTSTEFSATVATESVVLNYDKDGRLGVGKVVEQGKAGSIDAAGDIYAGGRQVQQFQLTDNNGALNRGQYNDVWNKRETEFTWRSNKYEDNPTGTRGEWGLFQNFWLDSWKMVQSFITMSGRMFIRTANDGNSWRPNKWKEVLFKQDFEQNNWQKLVLQSGWNHHSTYGDAFYSKTLDGIVYLRGNVHKGLIDKEATIAVLPEGFRPKVSMYLQALNNSYGNAILCIYTDGRLVVKSNVDNSWLNLDNVSFRI CAE1B9AA53D96AD7 hypothetical protein/signal peptide/glnq partial protein protein bpdp1 Pneumococcus phage Dp-1 e7dn74_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MSIKFKTEELSKIVSQLNKLKPSKLLEITNYWHIFGDGECVMFTAYDGSNFLRCIIDSDVEIDVIVKAEQFGKLVEKTTAATVTLVPEESSLKVIGNGEYNIDIVTEDEEYPTFDHLLEDVSEENALTLKSSLFYGIANINDSAVSKSGADGIYTGFLLKGGKAITTDIIRVCINPIKEKGLEMLIPYNLMSILASIPDEKMYFWQIDDTTVYISSASVEIYGKLMEGMEDYEDVSQLDSIEFEDDAAIPTAEILSVLDRLVLFTSAFDKGTVEFLFLKDRLRIKTSTSSYEDIMYASAGKKVSKKEFTCHLNSLLLKEIVSTVTEENFTVSYGSETAIKISSNGVVYFLALQEPEE 359F0D65F8866792 hypothetic protein /signal peptide/rholike domain /lipoprotein anchor protein protein bpdp1 Pneumococcus phage Dp-1 e7dn79_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MKLEQLMKDWNKDSKALVAVQGLEREALPRIPFSAPSMNYQTYGGLPRKRVVEFFGPESSGKTTSALDIVKNAQMVFEQEWEQKTEELKEKLENARASKASKTAVKELEMQLDSLQEPLKIVYLDLENTLDTEWAKKIGVDVDNIWIVRPEMNSAEEILQYVLDIFETGEVGLVVLDSLPYMVSQNLIDEELTKKAYAGISAPLTEFSRKVTPLLTRYNAIFLGINQIREDMNSQYNAYSTPGGKMWKHACAVRLKFRKGDYLDENGASLTRTARNPAGNVVESFVEKTKAFKPDRKLVSYTLSYHDGIQIENDLVDVAVEFGVIQKAGAWFSIVDLETGEIMTDEDEEPLKFQGKANLVRRFKEDDYLFDMVMTAVHEIITREEG 1C23A1029B91FCF5 structural listeria bacteroides repeat domain protein Hypothetical protein/Zn-finger domain. protein protein bpdp1 Pneumococcus phage Dp-1 Similar to NP_781743 e7dnc3_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MGVDIEKGVAWMQARKGRVSYSMDFRDGPDSYDCSSSMYYALRSAGASSAGWAVNTEYMHAWLIENGYELISENAPWDAKRGDIFIWGRKGASAGAGGHTGMFIDSDNIIHCNYAYDGISVNDHDERWYYAGQPYYYVYRLTNANAQPAEKKLGWQKDATGFWYARANGTYPKDEFEYIEENKSWFYFDDQGYMLAEKWLKHTDGNWYWFDRDGYMATSWKRIGESWYYFNRDGSMVTGWIKYYDNWYYCDATNGDMKSNAFIRYNDGWYLLLPDGRLADKPQFTVEPDGLITAKV C17F0911B7D46CC1 e7dna1_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MTISLRNKLPKFNFVPFSKKQLQLLTWWTKGSPFRTFDIVIADGSIRSGKTVSMALSFSLWAMTEFNGQNFAICGKTIHSARRNVIQPLKQMLTSRGYEIRDVRNENLLIIRHFRNGEEIVNYFYIFGGKDESSQDLIQGVTLAGIFCDEVALMPESFVNQATGRCSVTGSKMWFSCNPANPNHYFKKNWIDKQVEKRILYLHFTMDDNPSLTDSIKRRYEKMYAGVFRKRFILGLWVTADGLVYSMFNEEQHVKKLNIEFDRLFVAGDFGIYNATTFGLYGFSKRHKRYHLIESYYHSGREAEEQLTEADVNSNIQFSSVLQKTTKEYANDLVDMIRGKQIEYIILDPSASAMIVELQKHPYIARKNIPIIPARNDVTLGISFHAELLAENRFTLDPSNTHDIDEYYAYSWDSKASQTGEDRVIKEHDHCMDRNRYACLTDALINDDFGFEIQILSGKGARN E972C194853BA19C e7dn80_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MRHGDDCGSRNYHSRRRLMQKSLFGPKLVPASSRRKKRTVPKPKPKIDEQVVELMNRRERQVLVHSCIYYYFNDSIIADGQYDKWSHELYSLIVSHPDEFRQTVLYNEFKQFDGNTGMGLPYDCQFAVRVAERLLRK 35A2240C979C41AF e7dnd5_bpdp1 DNA-directed DNA polymerase protein protein bpdp1 Pneumococcus phage Dp-1 MAQKGLFGAKPRSSKKNDAQLLAQRKNRKPAVEVTYISGNALKDAVARARTLSTRILGHVLDRLELITEEAKLEQYVDKMIEDGIGSIDVETDGLDTIHDELAGVCLYSPSQKGIYAPVNHVSNMTKMRIKNQISPEFMKKMLQRIVDSGIPVIYHNSKFDMKSIYWRLGVKMNEPAWDTYLAAMLLNENESHSLKSLHSKYVRNEENAEVAKFNDLFKGIPFSLIPPDVAYMYAAYDPLQTFELYEFQEQYLTPGTEQCEEYNLEKVSWVLHNIEMPLIKVLFDMEVYGVDLDQDKLAEIREQFTANMNEAEQEFQQLVSEWQPEIEELRQTNFQSYQKLEMDARGRVTVSISSPTQLAILFYDIMGLKSPERDKPRGTGESIVEHFDNDISKALLKYRKYAKLVSTYTTLDQHLAKPDNRIHTTFKQYGAKTGRMSSENPNLQNIPSRGEGAVVRQIFAASEGHYIIGSDYSQQEPRSLAELSGDESMRHAYEQNLDLYSVIGSKLYGVPYEECLEFYPDGTTNKEGKLRRNSVKSVLLGLMYGRGANSIAEQMNVSVKEANKVIEDFFTEFPKVADYIIFVQQQAQDLGYVQTATGRRRRLPDMSLPEYEFEYIDASKNEDFDPFNFDADQQMDDTVPEHIIEKYWAQLDRAWGFKKKQEIKDQAKAEGILIKDNGGKIADAQRQCLNSVIQGTAADMTKYAMIKVHNDAELKELGFHLMIPVHDELLGEVPIKNAKRGAERLTEVMIEAAKDIISLPMKCDPSIVERWYGEEIEI 5BC255FE0FEC0AAC e7dn67_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MRVSKTLTFDAAHQLVGHFGKCANLHGHTYKVEISLAGGTYDHGSSQGMVVDFYHVKKIAGTFIDRLDHAVLLQGNEPIALANAVDTKRVLFGFRTTAENMSRFLTWTLTELMWKHARIDSIKLWETPTGCAECTYYEIFTEDEIEMFKNVTFIDKDEKITVREILEQEQDNG 80767AD78ECBFB18 hypothetical protein protein protein bpdp1 Pneumococcus phage Dp-1 Similar to C4Z5Z0 e7dn82_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MIGQGLVKSTISKWKQLPKYIIVEGEVGSGRKTLIRYIASKFDADSIVVGTSVDDIRNIIQDAQTIFKARIYVIDGNSLSMSALNSLLKIAEEPPLNCHIAMTVDSINNALPTLASRAKVLTMLPYTNEEKMQFVKSYKKVDTSGIDDRAIVDYCNLASNLQMLEDILEYGAEELFEKVTTFYDLIWEASASNSLKVTNWLKFKETDEGKIEPKLFLNCLLNWSTVVIRKHYVEMSFEELEAHDLLVREASRCLRKVSKKGSNARVCVNEFIRRVKQVE 5E6B27C4408F66AB e7dnb8_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MIDNNLPMSPIPGEIVQVYDQNFNLIGASDEIFSKHYEDEIVTRARGKETFTFESIETSSIYQHLKVENIIQYGGRWFRIKYAQDVEDVKGLTKFTCYALWYELAEGLPRKLKHVASSVGAVALDIIKDAGEWVRLVCPPDGANKQVRSITAAENSMLWHLRYLAKQYNLELTFGYEEIIKQEVRIVQTVVFLQPYVESKVDFPLVVEENLKYVTRQEDSRNLCTAYKLTGKKEEGSQEPLTFASINNGSEYLIDVSWFTTRHMKPRYIAKSKSDEHFRIKENLMSAARAYLDIYSRPLIGYEASAVLYNKVPDLHHTQLIVDDHYDVIEWRKISARKIDYDDLSNSTIIFQDPRKDLMDLLNEDGEGVLSGETVNESQVVIRYADDILGTNFNAESGKYIGVLNTNKKPSELVPDDFTWIRLEGPKGDAGLPGAPGRDGVDGVPGKSGVGIADTAITYAVSVSGTQEPENGWSEQVPELIKGRFLWTKTFWRYTDGSHETGYSVAYIGQDGNSGKDGIAGKDGVGIAATEVMYASSPSATEAPAGGWSTQVPTVPGGQYLWTRTRWRYTDQTDEIGYSVSRMGEQGPKGDAGRDGIAGKNGIGLKSTSVSYGISPTDSAIPGVWASQVPSLIKGQYLWTRTIWTYTDSTTETGYQKTYIPKDGNDGKNGIAGKDGVGIKSTTITYAGSTSGTVAPTSNWTSAIPNVQPGFFLWTKTVWNYTDDTSETGYSVSKIGETGPRGVQGLQGPQGLQGIPGPAGADGRSQYTHLAFSNSPNGEGFSHTDSGRAYVGQYQDFNPVHSKDPAAYTWTKWKGNDGAQGIPGKPGADGKTNYFHIAYASSADGSREFSLEDNNQQYMGYYSDYEQADSRDRTKYRWFDRLANVQVGGRNEFLNSLFEFGLKPRYSSYNLMDGQDQTQGQISATIDERQRFKGANSLRLDSTWNGKPQNQKLTFSLGGDTRLGTPTEWSNLEGRISFWAKASRNGVSLAARPGYRSNVFTATLTDQWKFYDFKFFDKVNSNCTAEAIFHVFTQSCSVWLNHIKIELGNISTPFSEAEEDLKYRIDSKADQKLTNQQLTALTEKAQLHDAELKAKATMEQLSNLEKAYEGRMKANEEAIKKSEADLILAASRIEATIQELGGLRELKKFVDSYMSSSNEGLIIGKNDGSSTIKVSSDRISMFSAGNEVMYLTQGFIHIDNGIFTQSIQVGRFRTEQYSFNPDMNVIRYVG 1F7E48144BBDA6E5 e7dn66_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MKSVVLLSGGVDSATCLAIEVDKWGSKNVHAIAFNYGQKHEAELENAANVAMFYGVKFTILEIDSKIYSSSSSSLLQGKGEISHGKSYAEILAEKEVVDTYVPFRNGLMLSQAAAYAYSVGASYVVYGAHADDAAGGAYPDCTPEFYNSMSNAMEYGTGGKVTLVAPLLTLTKAQVVKWGIDLDVPYFLTRSCYESDAESCGTCATCIDRKKAFEENGMTDPIHYKEN EC654381190B24B4 e7dna5_bpdp1 protein protein bpdp1 Pneumococcus phage Dp-1 MAYQLEDLLKGLDEPTIKQVKEIISKTSKELDAKIFIDGDGQHFVPHARFDEVVQQRDAANGSINSYKEQVATLSKQVKDNGDAQTTIQNLQEQLDKQSQLAKGAVITSALHPLISDSIAPAADILGFMNLDNITVESDGKVKGLDEELKAVRESRKYLFKEVEVPAEQEAQAKSPAGTGNLGNPGRVGGGVPEPREIGSFGKQLAAAQQTAGAQEQSSFFK 998C84B98BDCC581 e7dn74-e7dn79 1 DNA polymerase III subunit �-clamp/ DnaN 12 unspecified role unspecified role bait bait RecA/Ploop NTPase 14 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dn74-e7dn80 1 DNA polymerase III subunit �-clamp/ DnaN 12 unspecified role unspecified role bait bait NAD-dependent DNA ligase 18 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dn80-e7dn74 1 DNA polymerase III subunit �-clamp/ DnaN 12 unspecified role unspecified role prey prey NAD-dependent DNA ligase 18 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dn74-e7dnd5 1 DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 19 unspecified role unspecified role prey prey DNA polymerase III subunit �-clamp/ DnaN 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dnd5-e7dn74 1 DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 19 unspecified role unspecified role bait bait DNA polymerase III subunit �-clamp/ DnaN 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dnd2-hypothetical_ 1 DNA primase/ DnaG Toprim domain 2 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 47.5 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role prey prey Hypothetical protein 21 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dn79-hypothetical_ 1 RecA/Ploop NTPase 14 unspecified role unspecified role bait bait Hypothetical protein/signal peptide/glnQ partial 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dn80-hypothetical_ 1 Hypothetical protein 21 unspecified role unspecified role prey prey NAD-dependent DNA ligase 18 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dn81-e7dn81 1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 3 unspecified role unspecified role prey prey "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 49.75 supplemental tables A, D and E e7dn81-e7dn82 1 DNA polymerase III gamma /tau subunit 22 unspecified role unspecified role prey prey "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dn81-e7dn82 1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 3 unspecified role unspecified role bait bait DNA polymerase III gamma /tau subunit 22 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 49.75 supplemental tables A, D and E e7dn82-e7dn81 1 "DNA polymerase III, clamp loader complex,gamma/tau/delta subunit/DnaX_nterm" 3 unspecified role unspecified role prey prey DNA polymerase III gamma /tau subunit 22 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dn65-e7dn65 1 Queuosine biosynthesis protein QueF /T-fold domain 4 unspecified role unspecified role prey prey Queuosine biosynthesis protein QueF /T-fold domain 4 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dnd5-hypothetical_ 1 DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 19 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein/signal peptide/glnQ partial 11 unspecified role unspecified role prey prey Hypothetical protein/signal peptide/glnQ partial 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role prey prey Hypothetical protein 21 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 24 supplemental tables A, D and E e7dn66-e7dn66 1 Queuosine biosynthesis protein QueC /ExsB domain 24 unspecified role unspecified role bait bait Queuosine biosynthesis protein QueC /ExsB domain 24 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 47.5 supplemental tables A, D and E e7dn66-hypothetical_ 1 Hypothetical protein 21 unspecified role unspecified role prey prey Queuosine biosynthesis protein QueC /ExsB domain 24 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 47.5 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dnd5-hypothetical_ 1 Hypothetical protein 21 unspecified role unspecified role prey prey DNA polymerase I/ DnaQ-like superfamily in N-terminus/ DnaA-polymmerase/ 3'-5' exonuclease 19 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetic protein /Signal peptide/Rho-like domain /lipoprotein anchor 13 unspecified role unspecified role prey prey Hypothetical protein 21 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 49 supplemental tables A, D and E e7dna1-hypothetical_ 1 "Terminase, large subunit/ Terminase 3 superfamily" 17 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role prey prey Hypothetical protein/Zn-finger domain 5 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dn68-e7dn67 1 Queuosine biosynthesis protein QueE/Radical-SAM 7 unspecified role unspecified role bait bait Queuosine biosynthesis protein QueD /T-fold domain 20 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dna7-e7dna5 1 Major capsid protein/ Phage_cap_E superfamily 9 unspecified role unspecified role bait bait Minor capsid protein/ Phage_GP20 25 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dna7-e7dna5 1 Major capsid protein/ Phage_cap_E superfamily 9 unspecified role unspecified role bait bait Minor capsid protein/ Phage_GP20 25 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dna7-hypothetic_pr 1 Major capsid protein/ Phage_cap_E superfamily 9 unspecified role unspecified role bait bait Hypothetic protein /Signal peptide/Rho-like domain /lipoprotein anchor 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dna7-hypothetic_pr 1 Hypothetic protein /Signal peptide/Rho-like domain /lipoprotein anchor 13 unspecified role unspecified role prey prey Major capsid protein/ Phage_cap_E superfamily 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E hypothetical_-e7dnd3 1 RNA polymerase sigma factor/Sigma_70_r2/Sigma70-ECF 8 unspecified role unspecified role prey prey Hypothetical protein 21 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 24.75 supplemental tables A, D and E e7dn68-e7dn68 1 Queuosine biosynthesis protein QueE/Radical-SAM 7 unspecified role unspecified role prey prey Queuosine biosynthesis protein QueE/Radical-SAM 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E structural_li-e7dnd3 1 RNA polymerase sigma factor/Sigma_70_r2/Sigma70-ECF 8 unspecified role unspecified role prey prey Structural Listeria Bacteroides repeat domain protein 15 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 24.75 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role prey prey Hypothetical protein 21 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E e7dnb8-e7dnb9 1 Antireceptor/ put_anti_recept TIGR1665 in N-terminus /DUF1142 in the middle /collagene binding repeats in the middle 23 unspecified role unspecified role bait bait Minor structural protein/DUF859 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 49 supplemental tables A, D and E e7dnb9-e7dnb9 1 Minor structural protein/DUF859 10 unspecified role unspecified role prey prey Minor structural protein/DUF859 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 24 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E hypothetic-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role bait bait Hypothetical protein 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dnc3-e7dnc3 1 Endolysin/N-terminus Amidase 5/ middle to C-terminus glucan-binding domain/ C-terminus CW_binding_1 16 unspecified role unspecified role bait bait Endolysin/N-terminus Amidase 5/ middle to C-terminus glucan-binding domain/ C-terminus CW_binding_1 16 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E s_layer_pr-hypotheti 1 Hypothetical protein 21 unspecified role unspecified role prey prey S -layer protein membranar peptidase (Hypothetical protein) 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E e7dnd2-e7dnd2 1 DNA primase/ DnaG Toprim domain 2 unspecified role unspecified role bait bait DNA primase/ DnaG Toprim domain 2 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 25 supplemental tables A, D and E hypothetical_-e7dnd3 1 Hypothetical protein 21 unspecified role unspecified role bait bait RNA polymerase sigma factor/Sigma_70_r2/Sigma70-ECF 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 50 supplemental tables A, D and E