IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. J. Biol. Chem. (0021-9258) 2010 imex curation McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Cancer - Interactions investigated in the context of cancer Parkinsons - Interactions investigated in the context of Parkinsons disease Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Cancer - Interactions investigated in the context of cancer Yaacov.Hod@stonybrook.edu Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu Accepted 2011-JAN-31 by MGT 06-April-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2010 jyoti Only protein-protein interactions imex curation DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. J. Biol. Chem. (0021-9258) 2010 imex curation McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Cancer - Interactions investigated in the context of cancer Parkinsons - Interactions investigated in the context of Parkinsons disease Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Cancer - Interactions investigated in the context of cancer Yaacov.Hod@stonybrook.edu Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu Accepted 2011-JAN-31 by MGT 06-April-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2010 jyoti Only protein-protein interactions imex curation DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. J. Biol. Chem. (0021-9258) 2010 imex curation McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Cancer - Interactions investigated in the context of cancer Parkinsons - Interactions investigated in the context of Parkinsons disease Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Cancer - Interactions investigated in the context of cancer Yaacov.Hod@stonybrook.edu Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu Accepted 2011-JAN-31 by MGT 06-April-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2010 jyoti Only protein-protein interactions imex curation DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. DJ-1 enhances cell survival through the binding of cezanne, a negative regulator of NF-{kappa}B. J. Biol. Chem. (0021-9258) 2010 imex curation McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Cancer - Interactions investigated in the context of cancer Parkinsons - Interactions investigated in the context of Parkinsons disease Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag McNally RS., Davis BK., Clements CM., Accavitti-Loper MA., Mak TW., Ting JP. Cancer - Interactions investigated in the context of cancer park7-/- MEFs used. Yaacov.Hod@stonybrook.edu Yaacov.Hod@stonybrook.edu,jenny_ting@med.unc.edu Accepted 2011-JAN-31 by MGT 06-April-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2010 jyoti Only protein-protein interactions imex curation otu7b_human OTU domain-containing protein 7B Zinc finger protein Cezanne Zinc finger A20 domain-containing protein 1 Cellular zinc finger anti-NF-kappa-B protein OTUD7B ZA20D1 protein protein human Homo sapiens Human MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVNAALSDFEQLRQVHAGNLPPSFSEGSGGSRTPEKGFSDREPTRPPRPILQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSNEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTSQRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALMEKGVEKEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGGVESSEEPVYESLEEFHVFVLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFSALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEVKLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTPESGDSDKESVGSSSTSNEGGRRKEKSKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGVGTGLGGSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPRPSGGGVHCQEPRRQLAGGPCVGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPDGELLVHRF DIP protein Q6GQQ9 original sequence version: 96 6D386C864B12EE57 otu7b_mouse OTU domain-containing protein 7B Otud7b Cellular zinc finger anti-NF-kappa-B protein Zinc finger A20 domain-containing protein 1 Zinc finger protein Cezanne protein protein mouse Mus musculus Mouse MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQVHAGNLSPPFSGGSTCPKTPEKGGSDREPTRPSRPILQRQDDVIQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSSEHPLEMPICAFQLPDLTVYKEDFRSFIERDLIEQSMLVALEQAGRLNWWVSMDSTCQRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYALMEKGVEKEALRRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGSNGASGGGVESSEEPVYESLEEFHVFVLAHVLKRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFSALVSMEQKESAKEQAVIPLTDSEHKLLPLHFAVDPGKGWEWGKDDNDNVRLASIILSLEVKLHLLHSYMNVKWIPLSSDSQAPLAQPESPTASAGDEPRSTPESGESDKESVGSSSLGNEGSRRKEKSKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGPKPGGLGSGSGISSGTETLEKKKKNNTLKSWKGGKEEAAGDGPVSEKPPSESVGNGGSKYSQEVMQSLSTMRIAMQGEGKYIFVGTLKMGHRHQYQEEMIQRYLADAEERFLAEQKQKEVERKIMNGGLVSGPPPAKKPEPDGGEDQPSDSPAEPKAMAFSTAYPGGFTIPRPSGGGVHCQEPRRQLAGGPCVGGLPSYATFPRQYPGRPYPHQDNIPALEPGKDGVHRGALLPPQFRVADSYSNGYREPPEPDGWAGAPRGLPPTQTKCKQPNCSFYGHPETNNLCSCCYREELRRREREPGGELLAHRF DIP protein B2RUR8 original sequence version: 45 B63C06B656CC02EE clcf1_mouse Cardiotrophin-like cytokine factor 1 Clcf1 Bsf3 Nnt1 B-cell-stimulating factor 3 Novel neurotrophin-1 protein protein mouse Mus musculus Mouse MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVNLEVWRSLNDRLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMATLGYPLPQPLPGTEPAWAPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAASVTLHLEAHGF 68B1FEAAB7F1A950 mtf1a_mouse Transcription termination factor 1a, mitochondrial Mterf1a Mitochondrial transcription termination factor 1a Mterf Mterf1 protein protein mouse Mus musculus Mouse MASRNIWCVRRNFLFDLRDWMLQYSAEVFLKSISFRPFSAECDSKDKESLEEEREDLLSNLVTMGVDIDMARRRQPGVFNKAVTNEQELKLFLLSKGASDKVIGSIISRYPRAITRTPESLSKRWDLWRKIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSVGLTHKCLCRLLTNAPRTFSNSLNLNKQMVEFLQETGMSLGHNDPRDFVRKIISKNPSILIQSTKRVKTNIEFLQSTFNLNKRDLLLLICGPGARILDLSNDCTKKNYTNIRERLLSLGCSEEEVQRFVLSYLNMVFLSEKKFNDKIDCLIEEKISASQIIENPRILDSSINTLKTRIRELSHAGYDLSTSSIALLSWSQRRYEAKLKRLCG 735133D605A04054 bbs1_mouse Bardet-Biedl syndrome 1 protein homolog Bbs1 protein protein mouse Mus musculus Mouse MAAASSSDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRNGSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTAMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMIKVLVLREGQSAPLLSAHINMPVSEGLAAA 322E9DD4DD554813 322E9DD4DD554813 park7_human Parkinson disease protein 7 PARK7 Oncogene DJ1 Parkinsonism-associated deglycase Maillard deglycase Protein DJ-1 Protein/nucleic acid deglycase DJ-1 protein protein human Homo sapiens Human MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD DIP protein Q99497 original sequence version: 102 4B21661B3A76BC67 park7-b2rur8 4 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig 1, TABLE 1. otud7b-park7 1 5 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association After immunoprecipitation of Cezanne, DJ-1 was co-immunoprecipitated in the presence of Cezanne but not in its absence as detected by immunoblot. Fig. 2A park7-otud7b-1 3 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Western blot of the immunoprecipitation samples showed the presence of endogenous Cezanne only in the samples where DJ-1 was immunoprecipitated. Fig. 2B H2O2 park7-otud7b-2 2 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q99497:p.Cys106Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:28:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys106ala' Tue Jun 30 17:50:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys106Ala' n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association The C106A mutant DJ-1 co-precipitated Cezanne at a reduced level compared to wild type DJ-1 but more than the untransfected negative control. Figs. 2C, 2E