MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Spatial and temporal organization of the E. coli PTS components. Spatial and temporal organization of the E. coli PTS components. EMBO J. (0261-4189) 2010 imex curation Lopian L., Elisha Y., Nussbaum-Shochat A., Amster-Choder O. suggested by luana Only protein-protein interactions ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lopian L., Elisha Y., Nussbaum-Shochat A., Amster-Choder O. suggested by luana EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Spatial and temporal organization of the E. coli PTS components. Spatial and temporal organization of the E. coli PTS components. EMBO J. (0261-4189) 2010 imex curation Lopian L., Elisha Y., Nussbaum-Shochat A., Amster-Choder O. suggested by luana Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Lopian L., Elisha Y., Nussbaum-Shochat A., Amster-Choder O. suggested by luana EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Spatial and temporal organization of the E. coli PTS components. Spatial and temporal organization of the E. coli PTS components. EMBO J. (0261-4189) 2010 imex curation Lopian L., Elisha Y., Nussbaum-Shochat A., Amster-Choder O. suggested by luana Only protein-protein interactions ecoli Escherichia coli (strain K12) fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lopian L., Elisha Y., Nussbaum-Shochat A., Amster-Choder O. suggested by luana EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation pt1_ecoli Phosphoenolpyruvate-protein phosphotransferase Phosphotransferase system, enzyme I ptsI b2416 JW2409 protein protein ecoli Escherichia coli (strain K12) MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDDEYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMRAVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAIRIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC DIP protein P08839 original sequence version: 148 DIP protein P08839 original sequence version: 162 DIP protein P08839 original sequence version: 125 DIP protein P08839 original sequence version: null 4278F0838855E950 pthp_ecoli Phosphocarrier protein HPr ptsH hpr b2415 Histidine-containing protein JW2408 protein protein ecoli Escherichia coli (strain K12) MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE DIP protein P0AA04 original sequence version: 78 DIP protein P0AA04 original sequence version: 47 DIP protein P0AA04 original sequence version: 56 E5C8879C0A95AD41 bglg_ecoli Cryptic beta-glucoside bgl operon antiterminator bglG bglC b3723 JW3701 protein protein ecoli Escherichia coli (strain K12) MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRAGERINSSGIEKEYALSSHELNGRLSELLSHIPLEVMATCDRIISLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMHLVSAQMSGNMEDVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQAWQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH DIP protein P11989 original sequence version: null 5ACF1A14BF438B4F bglg-ptsh 2 bglG 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P11989:p.Asp100Asn mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:20:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:22:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp100asn' Tue Jun 30 17:43:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp100Asn' Hpr 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0AA04:p.His15Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:57:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:55:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his15ala' Tue Jun 30 18:44:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His15Ala' direct interaction direct interaction f6 mint bglg-ptsh-1 2 bglG 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P11989:p.His160Tyr mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Tue Jul 12 10:21:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:02:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his160tyr' Tue Jun 30 18:24:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His160Tyr' mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Hpr 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0AA04:p.His15Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:57:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:47:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his15ala' Tue Jun 30 18:21:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His15Ala' direct interaction direct interaction f6 mint bglg-ptsh-2 2 bglG 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P11989:p.His208Arg mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H R Tue Jul 12 10:57:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:13:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his208arg' Tue Jun 30 16:36:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His208Arg' mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Hpr 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0AA04:p.His15Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:57:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:35:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his15ala' Tue Jun 30 15:59:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His15Ala' direct interaction direct interaction f6 mint bglg-ptsi 2 bglG 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P11989:p.His208Arg mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H R Tue Jul 12 10:57:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:04:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his208arg' Tue Jun 30 19:33:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His208Arg' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EI 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P08839:p.His189Ala mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:21:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:23:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his189ala' Tue Jun 30 18:59:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His189Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f6 mint bglg-ptsi-1 1 bglG 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P11989:p.His208Arg mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H R Tue Jul 12 10:50:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:13:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his208arg' Tue Jun 30 19:31:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His208Arg' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EI 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P08839:p.His189Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:07:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:40:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his189ala' Tue Jun 30 16:18:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His189Ala' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association t1 domino mint bglg-ptsh-3 1 bglG 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Hpr 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint bglg-ptsh-4 3 bglG 6 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Hpr 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization mint f5c f5e bglg-ptsi-2 3 bglG 6 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EI 4 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P08839:p.His189Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:06:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:54:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his189ala' Tue Jun 30 17:24:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His189Ala' colocalization colocalization mint f5b f5d f5f sf6a