MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. EMBO J. (0261-4189) 2010 imex curation Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. EMBO J. (0261-4189) 2010 imex curation Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. Lysosomal fusion and SNARE function are impaired by cholesterol accumulation in lysosomal storage disorders. EMBO J. (0261-4189) 2010 imex curation Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Fraldi A., Annunziata F., Lombardi A., Kaiser HJ., Medina DL., Spampanato C., Fedele AO., Polishchuk R., Sorrentino NC., Simons K., Ballabio A. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation lamp1_mouse Lysosome-associated membrane glycoprotein 1 Lysosomal membrane glycoprotein A 120 kDa lysosomal membrane glycoprotein LGP-120 P2B CD107 antigen-like family member A Lamp1 Lamp-1 protein protein mouse Mus musculus Mouse MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI C1BD373548BB9655 stx7_mouse Syntaxin-7 Stx7 Syn7 protein protein mouse Mus musculus Mouse MSYTPGIGGDSAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQLLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKAQRQAAEREKEFVARVRASSRVSGGFPEDSSKEKNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDMIDSIEANVESAEVHVQQANQQLSRAADYQRKSRKTLCIIIFILVVRIVIICLIVWGLKG 62F4E4B33F247ADB vti1b_mouse Vesicle transport through interaction with t-SNAREs homolog 1B Vesicle transport v-SNARE protein Vti1-like 1 Vti1-rp1 Vti1b Vti1l1 protein protein mouse Mus musculus Mouse MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDENQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRSTPLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFRHH DIP protein O88384 original sequence version: 97 DIP protein O88384 original sequence version: 87 DIP protein O88384 original sequence version: 92 6827DCAF9650DFC6 vamp7_mouse Vesicle-associated membrane protein 7 Vamp7 Sybl1 Synaptobrevin-like protein 1 protein protein mouse Mus musculus Mouse MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKSLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK DIP protein P70280 original sequence version: 98 109DBA4BE5772B0C goga1_mouse Golgin subfamily A member 1 Golga1 Golgin-97 protein protein mouse Mus musculus Mouse MFAKLKKKIAEETAVAQRPGGTTRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQASRAKMAEGLALALARKDQEWSEKMEQLEKDKRFLTSQLQEVKNQSLSLFQKRDEIDELEGFQQQEISKVKHMLLKKEECLGKMEQELDARTRELNRTQEELVTSNQLSSDLNERLEELQRHCSTLEEQRDHLTASKAGAEHKIVVLEQKEQELQAIIQQHSIDLQKVTAETQEKEKVITHLQEKVIFLEKRLEQNLSGEDHVQELLKEKTVAEQNLEDTRQQLLAARNSHTKALYLLETRVKDLERSLQAAEEQLSQSRNVVADQEAQIQKLITTNQENSLSQQQVLALEQHCRERIHALEAQIEALEQTRVADQIASEQGMLQLQQENVALKESRNECEHSLQHHQLELKKLKDEWSQREIVSVAMAQALEEVRKQREEFQQQATELTAIIEEKNQSLCEKDEALLQKEQELRQLEKGHSSALLQMHKLQRELEALKTCKAQEAMPATTGEDCLPLQGQEPLVISKAMQNSEYELPAAEGTPNGEVGASDLKQLQKEKQDLEQQLIEKNKIMKQMQQRMLELKKTLQKELKIRPDSELFEVREKTGPEIPNMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSKPTPKGSIRPSISNPRIPWS 5F2AECF0D91784D2 vti1b-stx7 2 Vti1b 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Syntaxin-7 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Vamp7 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f6b mint lamp1-vamp7 1 Vamp7 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell lamp1 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Vti1b 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f7a homomint mint golga1-lamp1 1 Golgin-97 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Vti1b 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell LAMP1 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization homomint mint sf5 stx7-vamp7 3 Syntaxin-7 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Vamp7 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Vti1b 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f5a mint Treatment of LSD cells with MBCD resulted in the dissociation of SNAREs from the DRMs and in an increased localization of SNAREs to soluble and intermediate region s of the gradient, thus restoring a SNAREs distribution similar to that observed in the WT cells. Conversely, loading WT cells with cholesterol resulted in an increased association of SNAREs with DRM regions, thus mimicking the condition observed in LSD cells.