InnateDB InnateDB Activation of the aryl hydrocarbon receptor induces human type 1 regulatory T cell-like and Foxp3(+) regulatory T cells. Activation of the aryl hydrocarbon receptor induces human type 1 regulatory T cell-like and Foxp3(+) regulatory T cells. Nat. Immunol. (1529-2908) 2010 imex curation Gandhi R., Kumar D., Burns EJ., Nadeau M., Dake B., Laroni A., Kozoriz D., Weiner HL., Quintana FJ. This experiment relates to a negative interaction. fquintana@rics.bwh.harvard.edu species of foxp3, aiolos cDNA confirmed through author correspondence. 21-Dec-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Gandhi R., Kumar D., Burns EJ., Nadeau M., Dake B., Laroni A., Kozoriz D., Weiner HL., Quintana FJ. This experiment relates to a negative interaction. fquintana@rics.bwh.harvard.edu species of foxp3, aiolos cDNA confirmed through author correspondence. Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity foxp3_human Forkhead box protein P3 Scurfin FOXP3 IPEX JM2 protein protein human Homo sapiens Human MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP DIP protein Q9BZS1 original sequence version: 139 DIP protein Q9BZS1 original sequence version: 131 91737C3CEA665A15 q9ukt9-14 Zinc finger protein Aiolos Aio-1-5a IKZF3 ZNFN1A3 Ikaros family zinc finger protein 3 protein protein human Homo sapiens Human MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTGTGWGWVELSHLGIRLQDLNVPWCRLH foxp3-q9ukt9_14-1 1 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait physical association physical association true Fig. 8B, 8D.