MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The cardiac troponin C mutation Leu29Gln found in a patient with hypertrophic cardiomyopathy does not alter contractile parameters in skinned murine myocardium. The cardiac troponin C mutation Leu29Gln found in a patient with hypertrophic cardiomyopathy does not alter contractile parameters in skinned murine myocardium. Basic Res. Cardiol. (0300-8428) 2009 Neulen A., Stehle R., Pfitzer G. suggested by panni Axel.Neulen@uni-koeln.de in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Neulen A., Stehle R., Pfitzer G. suggested by panni Axel.Neulen@uni-koeln.de Basic Res. Cardiol. (0300-8428) 2009 pp1a_mouse Serine/threonine-protein phosphatase PP1-alpha catalytic subunit Ppp1ca Ppp1a protein protein mouse Mus musculus Mouse MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK 8FBFD158A52282E0 tnnc1_mouse Troponin C, slow skeletal and cardiac muscles Tnnc1 Tncc protein protein mouse Mus musculus Mouse MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 34DCC903C157A312 ppp1ca-tnnc1 1 2 enzyme enzyme neutral component neutral component 3 enzyme target enzyme target substrate substrate neutral component neutral component dephosphorylation dephosphorylation reaction dephosphorylation F3 homomint mint