MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The protein tyrosine phosphatase PTPN4/PTP-MEG1, an enzyme capable of dephosphorylating the TCR ITAMs and regulating NF-kappaB, is dispensable for T cell development and/or T cell effector functions. The protein tyrosine phosphatase PTPN4/PTP-MEG1, an enzyme capable of dephosphorylating the TCR ITAMs and regulating NF-kappaB, is dispensable for T cell development and/or T cell effector functions. Mol. Immunol. (0161-5890) 2008 Young JA., Becker AM., Medeiros JJ., Shapiro VS., Wang A., Farrar JD., Quill TA., Hooft van Huijsduijnen R., van Oers NS. suggested by santonico partial coverage rapid curation in vitro In vitro phosphatase assay phosphatase assay western blot western blot Immuno blot Immuno blot Young JA., Becker AM., Medeiros JJ., Shapiro VS., Wang A., Farrar JD., Quill TA., Hooft van Huijsduijnen R., van Oers NS. suggested by santonico Mol. Immunol. (0161-5890) 2008 partial coverage rapid curation The protein tyrosine phosphatase PTPN4/PTP-MEG1, an enzyme capable of dephosphorylating the TCR ITAMs and regulating NF-kappaB, is dispensable for T cell development and/or T cell effector functions. The protein tyrosine phosphatase PTPN4/PTP-MEG1, an enzyme capable of dephosphorylating the TCR ITAMs and regulating NF-kappaB, is dispensable for T cell development and/or T cell effector functions. Mol. Immunol. (0161-5890) 2008 Young JA., Becker AM., Medeiros JJ., Shapiro VS., Wang A., Farrar JD., Quill TA., Hooft van Huijsduijnen R., van Oers NS. suggested by santonico partial coverage rapid curation in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Young JA., Becker AM., Medeiros JJ., Shapiro VS., Wang A., Farrar JD., Quill TA., Hooft van Huijsduijnen R., van Oers NS. suggested by santonico Mol. Immunol. (0161-5890) 2008 partial coverage rapid curation The protein tyrosine phosphatase PTPN4/PTP-MEG1, an enzyme capable of dephosphorylating the TCR ITAMs and regulating NF-kappaB, is dispensable for T cell development and/or T cell effector functions. The protein tyrosine phosphatase PTPN4/PTP-MEG1, an enzyme capable of dephosphorylating the TCR ITAMs and regulating NF-kappaB, is dispensable for T cell development and/or T cell effector functions. Mol. Immunol. (0161-5890) 2008 Young JA., Becker AM., Medeiros JJ., Shapiro VS., Wang A., Farrar JD., Quill TA., Hooft van Huijsduijnen R., van Oers NS. suggested by santonico partial coverage rapid curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Young JA., Becker AM., Medeiros JJ., Shapiro VS., Wang A., Farrar JD., Quill TA., Hooft van Huijsduijnen R., van Oers NS. suggested by santonico Mol. Immunol. (0161-5890) 2008 partial coverage rapid curation ptn4_mouse Tyrosine-protein phosphatase non-receptor type 4 Ptpn4 Testis-enriched protein tyrosine phosphatase protein protein mouse Mus musculus Mouse MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDIVFKHLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLSCPCNTAALLASFAVQSELGDYNQSENLAGYLSDYSFIPNQPQDFEKEIAKLHQQHVGLSPAEAEFNYLNAARTLELYGVEFHYARDQSNNEILIGVMSGGILIYKNRVRMNTFLWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKTLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPSKPLARKLMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSSFTQEATRVRPSSVGHLVDHVVHMSPSEDFVSQRSPSSTQANSIVLESSPSQETPEDGQPPALPPKQSKKNSWNQIHFSNSQQDLVTHTNESFDVPSSPEKSTPNGGIPHDNLVLIKMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCEKHSGELVLLVRPNAVYDVVEEKLESEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLAQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVLLKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCKDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPSESSSYGCYQVTCHSEEGNPAYIFRKMTLFNQEKNESRQLTQIQYTAWPDHGVPDDSSDFLDFVCHVRDQRAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLTTSSNK mint May act at junctions between the membrane and the cytoskeleton 73E465D804C9C5FB ptn3_mouse Tyrosine-protein phosphatase non-receptor type 3 Ptpn3 protein protein mouse Mus musculus Mouse MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGPLSPKDSDSEVSQNHSPHRESLSENNPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQRFLEDYHKVTKGGFVEDASQYYCDKSDDGDGYLVLIRITPDEEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVSFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEMPAANLVNKYIATQGPLPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQTEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVDGEPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQRLDPS mint 8D86101FA691142A cd3z_mouse T-cell surface glycoprotein CD3 zeta chain Cd247 Cd3z Tcrz T-cell receptor T3 zeta chain protein protein mouse Mus musculus Mouse MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR mint 1B8022035A312831 ptpn4-cd247 2 4 unspecified role unspecified role bait bait trap-mutant trapping mutant trap-mutant trapping mutant trap-mutant mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trap-mutant trapping mutant trap-mutant trapping mutant trap-mutant mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Cys842Ser 6 unspecified role unspecified role prey prey physical association physical association F1A mint ptpn3-cd247 2 5 unspecified role unspecified role bait bait trap-mutant trapping mutant trap-mutant trapping mutant trap-mutant mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trap-mutant trapping mutant trap-mutant trapping mutant trap-mutant mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Cys842Ser 6 unspecified role unspecified role prey prey physical association physical association F1A mint cd247-ptpn4 1 6 enzyme target enzyme target substrate substrate neutral component neutral component 4 enzyme enzyme neutral component neutral component dephosphorylation dephosphorylation reaction dephosphorylation F1B mint cd247-ptpn4-1 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F1C mint