UniProt UniProt http://www.uniprot.org The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. Mol. Biol. Cell (1059-1524) 2008 mimix curation Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. hans-peter.hauri@unibas.ch 23-Sept-2011: Contacted by JYOTI. mgt human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2008 mgt mimix curation The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. Mol. Biol. Cell (1059-1524) 2008 mimix curation Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. hans-peter.hauri@unibas.ch 23-Sept-2011: Contacted by JYOTI. mgt human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). bn-page blue native page bn-page ms participant Identification by mass spectrometry ms participant Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Two dimensional gel electrophoresis on Surf4 protein complexes from ERGIC fractions. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2008 mgt mimix curation The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. Mol. Biol. Cell (1059-1524) 2008 mimix curation Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. hans-peter.hauri@unibas.ch 23-Sept-2011: Contacted by JYOTI. mgt human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2008 mgt mimix curation The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. Mol. Biol. Cell (1059-1524) 2008 mimix curation Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. hans-peter.hauri@unibas.ch 23-Sept-2011: Contacted by JYOTI. mgt human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. hans-peter.hauri@unibas.ch Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2008 mgt mimix curation The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. Mol. Biol. Cell (1059-1524) 2008 mimix curation Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. hans-peter.hauri@unibas.ch 23-Sept-2011: Contacted by JYOTI. mgt human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2008 mgt mimix curation lman1_human Protein ERGIC-53 LMAN1 ERGIC53 F5F8D ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 Gp58 Intracellular mannose-specific lectin MR60 protein protein human Homo sapiens Human MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF DIP protein P49257 original sequence version: 110 B87EF117C0CD386C tmeda_human Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmp-21-I p24delta S31III125 TMED10 TMP21 p23 p24 family protein delta-1 S31I125 protein protein human Homo sapiens Human MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE 0A0486BE65C4DBBB tmed9_human Transmembrane emp24 domain-containing protein 9 TMED9 GP25L2 Glycoprotein 25L2 p25 p24 family protein alpha-2 GMP25 protein protein human Homo sapiens Human MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV 9B6D2D517D9E77D8 surf4_human Surfeit locus protein 4 SURF4 SURF-4 protein protein human Homo sapiens Human MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 03366E29882B97A5 tmed2_human Transmembrane emp24 domain-containing protein 2 TMED2 RNP24 Membrane protein p24A p24 family protein beta-1 p24 protein protein human Homo sapiens Human MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV C452370E459DC894 tmed7_human Transmembrane emp24 domain-containing protein 7 TMED7 CGI-109 p24 family protein gamma-3 p27 protein protein human Homo sapiens Human MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS 9D0D2110579837B3 lman1-surf4 4 6 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 1 surf4-tmed10 2 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association 2B KDEL-receptor has also been identified but could be differentiated between KDELR1 AC:P24390 or KDELR2 AC:P33947 tmed10-surf4 3 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association 2c SURF4 has been detected by ant-HA antiobody tmed10-tmed2-1 3 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association 2c SURF4 has been detected by ant-HA antiobody surf4-tmed10-1 5 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 2c lman1-surf4-3 1 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2c lman1-surf4-4 3 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2D