UniProt UniProt http://www.uniprot.org The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction. The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction. J. Biol. Chem. (0021-9258) 2007 mimix curation Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C. Protein identity: gfi-1 was identified as human from atcc image clone no; pu.1 as mouse from ref 23 rao-1999 RDahl@salud.unm.edu 26-Sep-2011: Contacted by JYOTI. ORCHARD in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C. protein identity: gst-gfi-1 as mouse, is a gift from grimes working in moroy lab working w mouse (sent e-mail some time ago) Protein identity: gfi-1 was identified as human from atcc image clone no; pu.1 as mouse from ref 23 rao-1999 RDahl@salu.unm.edu RDahl@salud.unm.edu Accepted 2011-JUL-11 by ORCHARD 26-Sep-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2007 ORCHARD mimix curation The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction. The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction. J. Biol. Chem. (0021-9258) 2007 mimix curation Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C. Protein identity: gfi-1 was identified as human from atcc image clone no; pu.1 as mouse from ref 23 rao-1999 RDahl@salud.unm.edu 26-Sep-2011: Contacted by JYOTI. ORCHARD human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C. Protein identity: gfi-1 was identified as human from atcc image clone no; pu.1 as mouse from ref 23 rao-1999 RDahl@salu.unm.edu RDahl@salud.unm.edu Accepted 2011-JUL-11 by ORCHARD 26-Sep-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2007 ORCHARD mimix curation The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction. The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction. J. Biol. Chem. (0021-9258) 2007 mimix curation Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C. Protein identity: gfi-1 was identified as human from atcc image clone no; pu.1 as mouse from ref 23 rao-1999 RDahl@salud.unm.edu 26-Sep-2011: Contacted by JYOTI. ORCHARD human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C. Protein identity: gfi-1 was identified as human from atcc image clone no; pu.1 as mouse from ref 23 rao-1999 RDahl@salu.unm.edu RDahl@salud.unm.edu Accepted 2011-JUL-11 by ORCHARD 26-Sep-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2007 ORCHARD mimix curation gfi1_human Zinc finger protein Gfi-1 Growth factor independent protein 1 Zinc finger protein 163 GFI1 ZNF163 protein protein human Homo sapiens Human MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q99684 original sequence version: 93 DIP protein Q99684 original sequence version: 94 740A466F72C5FC72 spi1_mouse Transcription factor PU.1 Spi1 Sfpi1 Sfpi-1 31 kDa-transforming protein SFFV proviral integration 1 protein protein protein mouse Mus musculus Mouse MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHYWDFSAHHVHNNEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVSYMPRMCFPYQTLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRLPPH 765E9CC2F374EB6E gfi1_mouse Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein mouse Mus musculus Mouse MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPAPGRAEGGAVSAGESKMEPRERLSPDSQLTEAPDRASASPNSCEGSVCDPCSEFEDFWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGSEPGRPAARYGPEQAAGGAGAGQPGRCGVAGGATSAAGLGLYGDFAPAAAGLYERPSTAAGRLYQDHGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK 63AB726025300B6B spi1_human Transcription factor PU.1 SPI1 31 kDa-transforming protein protein protein human Homo sapiens Human MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH DIP protein P17947 original sequence version: 88 9592DAA1D85053ED spi1-gfi1 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 3a gfi1-spi1 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 3a spi1-gfi1-2 3 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3b gfi1-spi1-1 1 6 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey in vitro In vitro physical association physical association 3c no use of purified proteins mentioned hence only physical assoc spi1-gfi1-3 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association 3d no use of purified proteins mentioned hence only physical assoc