UniProt UniProt http://www.uniprot.org Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Mol. Cell. Biol. (0270-7306) 2005 mimix curation Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu 26-Sep-2011: Contacted by JYOTI. ORCHARD human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu Accepted 2011-JUL-13 by ORCHARD 26-Sep-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 ORCHARD mimix curation Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Mol. Cell. Biol. (0270-7306) 2005 mimix curation Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu 26-Sep-2011: Contacted by JYOTI. ORCHARD human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu Accepted 2011-JUL-13 by ORCHARD 26-Sep-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 ORCHARD mimix curation Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Mol. Cell. Biol. (0270-7306) 2005 mimix curation Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu 26-Sep-2011: Contacted by JYOTI. ORCHARD human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu Accepted 2011-JUL-13 by ORCHARD 26-Sep-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 ORCHARD mimix curation Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1. Mol. Cell. Biol. (0270-7306) 2005 mimix curation Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu 26-Sep-2011: Contacted by JYOTI. ORCHARD human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Duan Z., Zarebski A., Montoya-Durango D., Grimes H.L., Horwitz M. Source of G9a taken from PMID: 14985713 horwitz@u.washington.edu Accepted 2011-JUL-13 by ORCHARD 26-Sep-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2005 ORCHARD mimix curation gfi1_human Zinc finger protein Gfi-1 Growth factor independent protein 1 Zinc finger protein 163 GFI1 ZNF163 protein protein human Homo sapiens Human MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q99684 original sequence version: 93 DIP protein Q99684 original sequence version: 94 740A466F72C5FC72 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 gfi1_rat Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein rat Rattus norvegicus (Rat) Rat MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPVPGRADGGAVSAGESKMEPRERLSPESQLTEAPDRASASPNSCEGSVCDPSSEFEDYWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGAESGRPAARYGSEQAAGGAGAGQPGSCGAASGATSAGGLGLYGDFAPAAAGLFERPSTAAGRLYQDRGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q07120 original sequence version: 75 FC39B6100D684D14 ehmt2_human Histone-lysine N-methyltransferase EHMT2 KMT1C Histone H3-K9 methyltransferase 3 Euchromatic histone-lysine N-methyltransferase 2 HLA-B-associated transcript 8 Protein G9a Lysine N-methyltransferase 1C EHMT2 BAT8 G9A NG36 C6orf30 protein protein human Homo sapiens Human MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLEPAGPSSPASVTVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSPSKGGSCPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNGQPPVPEKRPPEIQHFRMSDDVHSLGKVTSDLAKRRKLNSGGGLSEELGSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALTEQLSEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGVTPPAGTAAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPLGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPELGSLPPVNT DIP protein Q96KQ7 original sequence version: 84 DIP protein Q96KQ7 original sequence version: 169 DIP protein Q96KQ7 original sequence version: 139 DIP protein Q96KQ7 original sequence version: 165 A6C5DC6B72801520 gfi1-ehmt2 3 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 3a gfi1-ehmt2 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 3b ehmt2-gfi1 2 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 3c gfi1-ehmt2-1 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 3c gfi1-hdac1 2 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 5a gfi1-hdac1-1 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 5b hdac1-gfi1 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 5b hdac1-gfi1-1 3 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 5c and d hdac1-ehmt2 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association 5e hdac1-ehmt2-1 3 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 5e ehmt2-gfi1-2 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 3D