MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Specific inactivation and nuclear anchoring of extracellular signal-regulated kinase 2 by the inducible dual-specificity protein phosphatase DUSP5. Specific inactivation and nuclear anchoring of extracellular signal-regulated kinase 2 by the inducible dual-specificity protein phosphatase DUSP5. Mol. Cell. Biol. (0270-7306) 2005 rapid curation Mandl M., Slack DN., Keyse SM., Mandl M., Slack DN., Keyse SM. suggested by panni 30-Sept-2013: Contacted by IntAct-Help. partial coverage yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mandl M., Slack DN., Keyse SM. suggested by panni Accepted 2013-SEP-25 by MARTA 30-Sept-2013: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2005 partial coverage rapid curation Specific inactivation and nuclear anchoring of extracellular signal-regulated kinase 2 by the inducible dual-specificity protein phosphatase DUSP5. Specific inactivation and nuclear anchoring of extracellular signal-regulated kinase 2 by the inducible dual-specificity protein phosphatase DUSP5. Mol. Cell. Biol. (0270-7306) 2005 rapid curation Mandl M., Slack DN., Keyse SM., Mandl M., Slack DN., Keyse SM. suggested by panni 30-Sept-2013: Contacted by IntAct-Help. partial coverage in vitro In vitro pull down pull down predetermined predetermined participant predetermined Mandl M., Slack DN., Keyse SM. suggested by panni Accepted 2013-SEP-25 by MARTA 30-Sept-2013: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2005 partial coverage rapid curation Specific inactivation and nuclear anchoring of extracellular signal-regulated kinase 2 by the inducible dual-specificity protein phosphatase DUSP5. Specific inactivation and nuclear anchoring of extracellular signal-regulated kinase 2 by the inducible dual-specificity protein phosphatase DUSP5. Mol. Cell. Biol. (0270-7306) 2005 rapid curation Mandl M., Slack DN., Keyse SM., Mandl M., Slack DN., Keyse SM. suggested by panni 30-Sept-2013: Contacted by IntAct-Help. partial coverage chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Mandl M., Slack DN., Keyse SM. suggested by panni Accepted 2013-SEP-25 by MARTA 30-Sept-2013: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2005 partial coverage rapid curation dus5_human Dual specificity protein phosphatase 5 DUSP5 Dual specificity protein phosphatase hVH3 VH3 protein protein human Homo sapiens Human MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECCVDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC mint homomint 2E4B2938F886CB4E mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E dusp5-mapk1 1 DUSP5 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified DUSP5 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association F1 homomint mint mapk1-dusp5 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association homomint mint fig.1 dusp5-mapk1-2 3 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization homomint mint fig.10