MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of a protein that interacts with the golli-myelin basic protein and with nuclear LIM interactor in the nervous system. Identification of a protein that interacts with the golli-myelin basic protein and with nuclear LIM interactor in the nervous system. J. Neurosci. Res. (0360-4012) 2004 Fernandes AO., Campagnoni CW., Kampf K., Feng JM., Handley VW., Schonmann V., Bongarzone ER., Reyes S., Campagnoni AT. suggested by lperfetto partial coverage rapid curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Fernandes AO., Campagnoni CW., Kampf K., Feng JM., Handley VW., Schonmann V., Bongarzone ER., Reyes S., Campagnoni AT. suggested by lperfetto J. Neurosci. Res. (0360-4012) 2004 partial coverage rapid curation ctds1_human Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 SCP1 Nuclear LIM interactor-interacting factor 3 CTDSP1 NIF3 NLIIF Small C-terminal domain phosphatase 1 protein protein human Homo sapiens Human MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS DIP protein Q9GZU7 original sequence version: 121 75A430BCA2748FEA ctds1_mouse Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 Ctdsp1 Nif3 Nliif Small C-terminal domain phosphatase 1 Nuclear LIM interactor-interacting factor 3 Golli-interacting protein protein protein mouse Mus musculus Mouse MDSSAVITQISKEEARGPLRGKGDQKSAVSQKPRSRGILHSLFCCVCRDDGEPLPAHSGAPLLVEENGAIPKHTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS mint homomint BFB4471390FE9091 ctdsp1-ctdsp1 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey direct interaction direct interaction f3c homomint mint ctdsp1-ctdsp1-1 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association f5b homomint mint