IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. Oncogene (0950-9232) 2004 imex curation Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Accepted 2011-NOV-07 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. Oncogene (0950-9232) 2004 imex curation Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Accepted 2011-NOV-07 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. Oncogene (0950-9232) 2004 imex curation Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Accepted 2011-NOV-07 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. Oncogene (0950-9232) 2004 imex curation Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Accepted 2011-NOV-07 by ORCHARD Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation ppia_rat Peptidyl-prolyl cis-trans isomerase A Ppia Cyclophilin A Cyclosporin A-binding protein Rotamase A p1B15 p31 protein protein rat Rattus norvegicus (Rat) Rat MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL 444C1ECF7F12841D ppia_human Peptidyl-prolyl cis-trans isomerase A Cyclophilin A Cyclosporin A-binding protein PPIA CYPA Rotamase A protein protein human Homo sapiens Human MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE DIP protein P62937 original sequence version: 81 DIP protein P62937-1 original sequence version: 141 9B2E637A555E4434 aifm1_mouse Apoptosis-inducing factor 1, mitochondrial Programmed cell death protein 8 Aifm1 Aif Pdcd8 protein protein mouse Mus musculus Mouse MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED A17EDFD5CF77BB85 aifm1_human Apoptosis-inducing factor 1, mitochondrial AIFM1 AIF PDCD8 Programmed cell death protein 8 protein protein human Homo sapiens Human MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED DIP protein O95831 original sequence version: 157 DIP protein O95831 original sequence version: 163 A156762BC64E6340 aifm1-ppia 4 5 unspecified role unspecified role prey prey cell lysate cell lysate rat-brain Rattus norvegicus brain brain Brain [cerebrum] 7 unspecified role unspecified role bait bait purified purified trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association text aifm1-ppia-5 2 8 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 1 This interaction only happens under apoptotic conditions and it is independent of caspase activity as assesed by caspase inhibitor Z-VAD.fmk treatment. aifm1-ppia-2 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2a Apoptosis-inducing conditions such as STS treatment or serum deprivation are required for the interaction to happen. aifm1-ppia-4 1 6 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2b