IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. Biochem. J. (0264-6021) 2004 imex curation Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr orchard Only protein-protein interactions Curated by Carol from InnateDB human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Accepted 2011-FEB-14 by ORCHARD Biochem. J. (0264-6021) 2004 orchard Only protein-protein interactions imex curation Curated by Carol from InnateDB The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. Biochem. J. (0264-6021) 2004 imex curation Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr orchard Only protein-protein interactions Curated by Carol from InnateDB in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. Interaction evidence was vague in the corresponding figure - lane 3 showing the pull down, the leg3 band is very faint. Interaction was stated in the text by authors. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Accepted 2011-FEB-14 by ORCHARD Biochem. J. (0264-6021) 2004 orchard Only protein-protein interactions imex curation Curated by Carol from InnateDB The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. Biochem. J. (0264-6021) 2004 imex curation Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr orchard Only protein-protein interactions Curated by Carol from InnateDB yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Accepted 2011-FEB-14 by ORCHARD Biochem. J. (0264-6021) 2004 orchard Only protein-protein interactions imex curation Curated by Carol from InnateDB The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. Biochem. J. (0264-6021) 2004 imex curation Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr orchard Only protein-protein interactions Curated by Carol from InnateDB human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Accepted 2011-FEB-14 by ORCHARD Biochem. J. (0264-6021) 2004 orchard Only protein-protein interactions imex curation Curated by Carol from InnateDB The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. Biochem. J. (0264-6021) 2004 imex curation Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr orchard Only protein-protein interactions Curated by Carol from InnateDB yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Accepted 2011-FEB-14 by ORCHARD Mouse embryonic 3T3 fibroblast cDNA Biochem. J. (0264-6021) 2004 orchard Only protein-protein interactions imex curation Curated by Carol from InnateDB The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins. Biochem. J. (0264-6021) 2004 imex curation Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr orchard Only protein-protein interactions Curated by Carol from InnateDB human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Paces-Fessy M., Boucher D., Petit E., Paute-Briand S., Blanchet-Tournier MF. sufu_mouse was identified from tag fluorescence; leg3_mouse and sap18_mouse were identified by immunofluorescence. Fig. 6. blanchet@ijm.jussieu.fr Accepted 2011-FEB-14 by ORCHARD Biochem. J. (0264-6021) 2004 orchard Only protein-protein interactions imex curation Curated by Carol from InnateDB sufu_mouse Suppressor of fused homolog Sufu protein protein mouse Mus musculus Mouse MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEEDSRSICLGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTHDRAPSRKDSLGSDSSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATEEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH 6ED5666BC4D4AFB5 gli1_human Zinc finger protein GLI1 GLI1 GLI Glioma-associated oncogene Oncogene GLI protein protein human Homo sapiens Human MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGSYGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLKSELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREGGPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETWGEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA E29B11D1A6CD3D91 rn19a_mouse E3 ubiquitin-protein ligase RNF19A Rnf19a Geg-154 Rnf19 Xybp Double ring-finger protein Gametogenesis-expressed protein GEG-154 RING finger protein 19A UBCM4-interacting protein 117 XY body protein protein protein mouse Mus musculus Mouse MQEQEISFIFKYNEGLCMNIDSDSILMSILDMSLHQQMGSDRDLQSSTSSVSLPSVKKAPKQRRISIGSLFRRKKDSKRKSRELNGGVDGIASIESIHSEMCADKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCLRQYLRIEISESRVNISCPECTERFNPHDIRLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKLTCGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKPCPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGVTLSVIVSPVVAAVTVGIGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDINVGGTNAAIDTTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRIGTIRDNLSETASTMALAGASITGSLSGSAMVNCFNRLEVQADVQKERCSLSGESGTVSLGTVSDNASTKAMAGSILNSYIPLDREGNSMEVQVDIESKPFKFRHNSGSSSVDDSGATRGHTGGASSGLPEGKSSATKWSKEATGGKKSKSGKLRKKGNMKINETREDMDAQLLEQQSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMRTSCSHGSSDCHARFTAVNTLPEVENDRLENSPHQCSSALLSKAASCSDVPQPSHAADEHGTSRSGGKPMVDLCFGDALRETNNNHSHQTADLKVAVQTEI AC117A35849C023A ncoa3_mouse Nuclear receptor coactivator 3 Ncoa3 Aib1 Pcip Rac3 Tram1 Amplified in breast cancer-1 protein homolog CBP-interacting protein Receptor-associated coactivator 3 Steroid receptor coactivator protein 3 Thyroid hormone receptor activator molecule 1 protein protein mouse Mus musculus Mouse MSGLGESSLDPLAAESRKRKLPCDAPGQGLVYSGEKWRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEPRRKDFLNTYQNPQLMEFLGLMRTRDKKAPYILIVRMLMKTHDILEDVNASPETRQRYETMQCFALSQPRAMLEEGEDLQCCMICVARRVTAPFPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYVHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTNDRHGFISTHFLQREQNGYRPNPIPQDKGIRPPAAGCGVSMSPNQNVQMMGSRTYGVPDPSNTGQMGGARYGASSSVASLTPGQSLQSPSSYQNSSYGLSMSSPPHGSPGLGPNQQNIMISPRNRGSPKMASHQFSPAAGAHSPMGPSGNTGSHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNISQPSKVSGQDSKSPLGLYCEQNPVESSVCQSNSRDPQVKKESKESSGEVSETPRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDPNCKDSSVSVTSPSGVSSSTSGTVSSTSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCGEGTTRQEQLSPKKKENNALLRYLLDRDDPSDVLAKELQPQADSGDSKLSQCSCSTNPSSGQEKDPKIKTETNDEVSGDLDNLDAILGDLTSSDFYNNPTNGGHPGAKQQMFAGPSSLGLRSPQPVQSVRPPYNRAVSLDSPVSVGSGPPVKNVSAFPGLPKQPILAGNPRMMDSQENYGANMGPNRNVPVNPTSSPGDWGLANSRASRMEPLASSPLGRTGADYSATLPRPAMGGSVPTLPLRSNRLPGARPSLQQQQQQQQQQQQQQQQQQQQQQQMLQMRTGEIPMGMGVNPYSPAVQSNQPGSWPEGMLSMEQGPHGSQNRPLLRNSLDDLLGPPSNAEGQSDERALLDQLHTFLSNTDATGLEEIDRALGIPELVNQGQALESKQDVFQGQEAAVMMDQKAALYGQTYPAQGPPLQGGFNLQGQSPSFNSMMGQISQQGSFPLQGMHPRAGLVRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENPAGTAVMRPMMPQAFFNAQMAAQQKRELMSHHLQQQRMAMMMSQPQPQAFSPPPNVTASPSMDGVLAGSAMPQAPPQQFPYPANYGMGQPPEPAFGRGSSPPSAMMSSRMGPSQNAMVQHPQPTPMYQPSDMKGWPSGNLARNGSFPQQQFAPQGNPAAYNMVHMNSSGGHLGQMAMTPMPMSGMPMGPDQKYC DIP protein O09000 original sequence version: 142 EF44E92735816C24 prdx6_mouse Peroxiredoxin-6 Lysophosphatidylcholine acyltransferase 5 Glutathione-dependent peroxiredoxin Antioxidant protein 2 1-Cys peroxiredoxin Acidic calcium-independent phospholipase A2 Non-selenium glutathione peroxidase Prdx6 Aop2 Ltw4 Prdx5 protein protein mouse Mus musculus Mouse MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP AECDEDD332858B8F ci_drome Transcriptional activator cubitus interruptus ci ci-D CG2125 ci form of 155 kDa ci full-length protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDAYALPTYFPLAYSELQFLASRRAAAVAAAATVLPGSPCINQHHPTDVSSSVTVPSIIPTGGTSDSIKTSIQPQICNENTLLGNAGHQHNHQPQHVHNINVTGQPHDFHPAYRIPGYMEQLYSLQRTNSASSFHDPYVNCASAFHLAGLGLGSADFLGSRGLSSLGELHNAAVAAAAAGSLASTDFHFSVDGNRRLGSPRPPGGSIRASISRKRALSSSPYSDSFDINSMIRFSPNSLATIMNGSRGSSAASGSYGHISATALNPMSHVHSTRLQQIQAHLLRASAGLLNPMTPQQVAASGFSIGHMPTSASLRVNDVHPNLSDSHIQITTSPTVTKDVSQVPAAAFSLKNLDDAREKKGPFKDVVPEQPSSTSGGVAQVEADSASSQLSDRCYNNVVNNITGIPGDVKVNSRLDEYINCGSISIPSNEYDCANADTTDIKDEPGDFIETNCHWRSCRIEFITQDELVKHINNDHIQTNKKAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKTVHGAEFYANKKHKGLPLNDANSRLQQNNSRHNLQEHNIDSSPCSEDSHLGKMLGTSSPSIKSESDISSSNHHLVNGVRASDSLLTYSPDDLAENLNLDDGWNCDDDVDVADLPIVLRAMVNIGNGNASASTIGGSVLARQRFRGRLQTKGINSSTIMLCNIPESNRTFGISELNQRITELKMEPGTDAEIKIPKLPNTTIGGYTEDPLQNQTSFRNTVSNKQGTVSGSIQGQFRRDSQNSTASTYYGSMQSRRSSQSSQVSSIPTMRPNPSCNSTASFYDPISPGCSRRSSQMSNGANCNSFTSTSGLPVLNKESNKSLNACINKPNIGVQGVGIYNSSLPPPPSSHLIATNLKRLQRKDSEYHNFTSGRFSVPSYMHSLHIKNNKPVGENEFDKAIASNARRQTDPVPNINLDPLTNISRFSTTPHSFDINVGKTNNIASSINKDNLRKDLFTVSIKADMAMTSDQHPNERINLDEVEELILPDEMLQYLNLVKDDTNHLEKEHQAVPVGSNVSETIASNHYREQSNIYYTNKQILTPPSNVDIQPNTTKFTVQDKFAMTAVGGSFSQRELSTLAVPNEHGHAKCESFHHQSQKYMNTDIGSKQQSALPSAHQRQTEKSNYNQIIDSSMTSLPELNVDSIYPRNETENIFKVHGDHDNEIQCGIISQSQMSPSTNLNNDGQFSTVNMQPITTSKLFPPEPQKIVCDTQASNTSVMHLDTYQRTLEYVQSCQNWMETNNTSTNQIQSLPGMPVNNTLFPDVSSSTHPYHGTNMVINDMTTSLTSLLEENRYLQMMQ DIP protein P19538 original sequence version: 136 DIP protein P19538 original sequence version: 27 C3232A71EF9B8004 fused_drome Serine/threonine-protein kinase fused fu CG6551 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRYAVSSLVGQGSFGCVYKATRKDDSKVVAIKVISKRGRATKELKNLRRECDIQARLKHPHVIEMIESFESKTDLFVVTEFALMDLHRYLSYNGAMGEEPARRVTGHLVSALYYLHSNRILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHVLTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVKWPSTLTSECRSFLQGLLEKDPGLRISWTQLLCHPFVEGRIFIAETQAEAAKESPFTNPEAKVKSSKQSDPEVGDLDEALAALDFGESRQENLTTSRDSINAIAPSDVEHLETDVEDNMQRVVVPFADLSYRDLSGVRAMPMVHQPVINSHTCFVSGNSNMILNHMNDNFDFQASLRGGGVAAKPIVAPTVRQSRSKDLEKRKLSQNLDNFSVRLGHSVDHEAQRKATEIATQEKHNQENKPPAEAISYANSQPPQQQPQQLKHSMHSTNEEKLSSDNTPPCLLPGWDSCDESQSPPIENDEWLAFLNRSVQELLDGELDSLKQHNLVSIIVAPLRNSKAIPRVLKSVAQLLSLPFVLVDPVLIVDLELIRNVYVDVKLVPNLMYACKLLLSHKQLSDSAASAPLTTGSLSRTLRSIPELTVEELETACSLYELVCHLVHLQQQFLTQFCDAVAILAASDLFLNFLTHDFRQSDSDAASVRLAGCMLALMGCVLRELPENAELVERIVFNPRLNFVSLLQSRHHLLRQRSCQLLRLLARFSLRGVQRIWNGELRFALQQLSEHHSYPALRGEAAQTLDEISHFTFFVT DIP protein P23647 original sequence version: 121 DIP protein P23647 original sequence version: 147 A7804E2749B79D0C cos_drome Kinesin-like protein costa cos cos2 costal-2 Kinesin-like protein costal2 CG1708 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEIPIQVAVRIFPHRELKDLLRSFGPTEPKKDAQAVDEGADSKDSEAQVPAAEKDNPSISETDPNGNAEQDSAADSKTIPDANGNDSGQKDYPDSAYCVQAIPISASALGLPSALPGGDPMDSIAAGLIQVGPHTVPVTHALPSSSSQEQVYHQTVFPLITLFLEGFDASVVTYGQRGQGKSYTLYGNVQDPTLTDSTEGVVQLCVRDIFSHISLHPERTYAINVGFVEICGGDVCDLLGMGNIHCTNVDAVFHWLQVGLSARQSLPAHTLFTLTLEQQWVSKEGLLQHRLSTASFSDLCGTERCGDQPPGRPLDAGLCMLEQVISTLTDPGLMYGVNGNIPYGQTTLTTLLKDSFGGRAQTLVILCVSPLEEHLPETLGNLQFAFKVQCVRNFVIMNTYSDDNTMIVQPAEPVPESNSSAGPLSQAGPGDNFGLQFAASQWSKLVTNAEGLFSKLIDSKLITEVEKEQIEEWLFLKQECEECLSSTEAMRQQKQLVPILEAEEPEDVNSEAANSESPNSDNENDTDNESHRPDLDDKIESLMEEFRDKTDALILEKHAEYLSKHPKAVMQSQDREIEAQPPEENGDDRKVSIGSRRRSVQPGASLSTAELAMLNRVASQQPPPPIDPESVVDPLESSSGEGIRQAALAAAAATAPIEQLQKKLRKLVAEIEGKQRQLREIEETIQVKQNIIAELVKNSDTRSHAKQRFHKKRAKLEAECDKAKKQLGKALVQGRDQSEIERWTTIIGHLERRLEDLSSMKHIAGESGQKVKKLQQSVGESRKQADDLQKKLRKECKLRCQMEAELAKLRESRETGKELVKAQGSPEQQGRQLKAVQARITHLNHILREKSDNLEEQPGPEQQETLRHEIRNLRGTRDLLLEERCHLDRKLKRDKVLTQKEERKLLECDEAIEAIDAAIEFKNEMITGHRSIDTSDRIQREKGEQMLMARLNRLSTEEMRTLLYKYFTKVIDLRDSSRKLELQLVQLERERDAWEWKERVLSNAVRQARLEGERNAVLLQRQHEMKLTLMLRHMAEETSASSASYGERALAPACVAPPVQASSDFDYDHFYKGGGNPSKALIKAPKPMPTGSALDKYKDKEQRSGRNIFAKFHVLTRYASAAAAGSSGSTAEESTALIESTTTATATTTSTTTTGAVGKVKDKALVSFRPEQLKRLMPAPTATKVTRQKNKIIIQDASRRN DIP protein O16844 original sequence version: 88 DIP protein O16844 original sequence version: 100 DIP protein O16844 original sequence version: 121 6DC898F8B4C8F20F cebpz_mouse CCAAT/enhancer-binding protein zeta Cebpz Cbf2 Cebpa-rs1 CCAAT-box-binding transcription factor protein protein mouse Mus musculus Mouse MSADQEPVAFLAKQPWRPKQVTEDPDEEDEEDGDEGKNGFSLEEVLRLGGTKQDYLMLATLDENEEVVDGGKKGTIDDLQQGELESFIQNLNLAKYSKSLIEEDEPEKKENASKKEAKLLKVENKKQKATEGKKTSEKKVKNKTVAEQRPESCPVSKAKKDKQPDVFEFLERQTMLLRPGGKWYDMEYSGEYSLEPQPPDVVSKYKALAQKLYEHEVSLFKSKTNNQKGGSSTWMKAIVSSGTLADRMAAMILLIQDDAVHTLQFVETLMSLVKKKGSKQQCLMALDTFKELLITDLLPDSRKLRVFSQHPFHKLEEMSSGNKDSRDRRLILWYYEHQLKHLVAEFVQVLETLSHDSLVTTKTRALVAAHELLCDKPEEEKALLVQVINKLGDPQNRIATKASHLLEVLLRKHPNMKGVVCGEIERLLFRSNISPKAQYYAICFLNQMVLSHEESELANKLITLYFCFFRTCIKKKDIESKMLSAILTGVNRAYPYSQIGDDKVREQVDTLFKVLHVVNFNTSVQALMLLFQVMNSQQTISDRYYTALYRKMLDPGLTTCSKQAMFLNLIYKSLKADIMLRRVKAFVKRLLQVTCTQMPPFICGALYLVSEILKAKPDLRSQLDDHPESDEENFVDVGDDSDDEKFTDADKGTATDAVKEVESKETEPESSAEAEKPKAASWVHFDNLKGGKQIKTYDPFSRNPLFCGAENTTLWELKKLSEHFHPSVALFAKTILEGNCIQYSGDPLQDFTLMRFLDRFVYRNPKLHKGKENTDSVVMQPKRKHFMKNVRDLAVNSKEFLAKEESQIPVDEVFFYRYYKKVAVVKDKQKRSADEESIEDIDDEEFENMIDTFEDDNCFPPGKDDIDFASNMKKTKGAKADLEDSESSDGELGDLDDDEVSLGSMNDEDFEIDEDGGTFMDVSDDESEDAPEFADANPKANTKKSKRKSEDDFDFAGSFQGQKKKKKSFNDSSLFVSAEEFGHLLDENMGSKFDTIGMNAMANRDNASFKQLKWEAERDDWLHNRDVKSIIKKKKNFRKKMKAPQKPKRQRK 8518FBAA30D9C41C leg3_mouse Galectin-3 Lgals3 35 kDa lectin Carbohydrate-binding protein 35 Galactose-specific lectin 3 IgE-binding protein L-34 galactoside-binding lectin Laminin-binding protein Lectin L-29 Mac-2 antigen protein protein mouse Mus musculus Mouse MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI 1B5A8A81093D68F6 gli3_human Transcriptional activator GLI3 GLI3 GLI3 full-length protein GLI3 form of 190 kDa protein protein human Homo sapiens Human MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEPHYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQMALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSESAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTMLNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALLGDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPRVPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTMDADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAGQQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVHPQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNRQPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQGYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLEGVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ DIP protein P10071 original sequence version: 149 423B7495FCE3C37C zn219_mouse Zinc finger protein 219 Znf219 Zfp219 protein protein mouse Mus musculus Mouse MEGSRPRILVGHLEPSPPAFDGELDLQRYSNGPGVSGTPGPGSPGMGAVGWSETRAGERRFPCPVCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPAARLLLELEERALLREARLGRARSSGGMQSSPAAEGLARPQVPSSSAFRCPFCKGKFRTSAERERHLHILHRPWKCSLCSFGSSQEEELLHHSLTAHGASERPLAATSTPEPPPPPQQEPRSALEPEPEPEPRPEPDREANPAPTPAPPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKASFDHACPVCGRCFKEPWFLKNHMKVHTSKLGPLRAPGPGSAPARAPQPPDLSLLAYEPLGPALLLAPAPAPAERREPPSLLGYLSVRAGEVRPNGEGADPGGGRSYGGFRPLPSALPNRARRHRTEEPEEEEEVVEAEEESWARGRSLGSLTSLHPNPGEGSGQPAPAAGTQARSTATQEENGLLVGGTRSEAGRGATGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGSLKYHLQRHHREQRSSAGPGPPPEPPPPSQRGSLQPQSGAKPTQASATWVEGTASTRPPSSSTGPGSRRKPASPGRTLRNGRGGEAEPLDLSLRAGPGGEAGAGGALHRCLFCPFATGAPELMALHLQVHHSRRARGRRQPRADTSPTYVRAPSGETPPSPPLEEEGSPGLSRSGEAGLGGQER 7F0E43159B73B0F4 roa1_mouse Heterogeneous nuclear ribonucleoprotein A1 Hnrpa1 hnRNP core protein A1 Helix-destabilizing protein HDP-1 Single-strand-binding protein Topoisomerase-inhibitor suppressed Hnrnpa1 Fli-2 Tis protein protein mouse Mus musculus Mouse MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF 59485C9FA1FF8AE1 q9vg38_drome Suppressor of fused homolog Su(fu) CG6054 Dmel\CG6054 SU(FU) SUFU Su(Fu) SuFu Sufu dSufu su(fu) sufu Dmel_CG6054 d Sufu protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAEANLDKKPEVKPPPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSVFELFPETLLNLQDDLEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDENNRQLTDTQMKREEPSFPQSMSMSSNSLHKSCPLDFQAQAPNCISLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKAQHLALTLVAESVTGSAVTVNEPYGVLGYWIQVLIPDELVPRLMEDFRSAGLDEKCEPKERLELEWPDKNLKLIIDQPEPVLPMSLDAAPLKM DIP protein Q9VG38 original sequence version: 107 31FA5AC7B9E49B6D pias1_mouse E3 SUMO-protein ligase PIAS1 Pias1 Ddxbp1 DEAD/H box-binding protein 1 Protein inhibitor of activated STAT protein 1 RING-type E3 ubiquitin transferase PIAS1 protein protein mouse Mus musculus Mouse MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPPTLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRTYSMAVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKKEVQEVTASYNGVDGCLSSTLEHQVASHNQSSNKNKKVEVIDLTIDSSSDEEEEEPPAKRTCPSLSPTSPLSNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPATNGSSSGSNSSLVSSNSLRESHGHGVASRSSADTASIFGIIPDIISLD DIP protein O88907 original sequence version: 48 8844364E8FEE4F7F setb1_mouse Histone-lysine N-methyltransferase SETDB1 Setdb1 Eset Kiaa0067 SET domain bifurcated 1 ERG-associated protein with SET domain protein protein mouse Mus musculus Mouse MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQYIDEELEKMDCIQQRKKQLAELETWVLQKESEVAYVDRLFDDASREVTNCESLVKDFYSKLGLQYHDSSSEDEASRPTEIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTRPNMGAVRSKGPVVQYTQDLTGTGIQFKPMEPLQPIAPPAPLPIPPLSPQAADTDLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSSTLSENVSAGKLGINQTYRSPLASVTSTPASAAPPVPPVPPGPPTPPGPPAPPGPLAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLPTGVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPTSSDSSGVDMKDQEDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENELSEMTSKDSRPPDLGPPHVPIPSSVSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGDGRAGGGRGEAERASTSGLSFKDEGDNKQPKKEDPENRNKMPVVTEGSQNHGHNPPMKSEGLRRPASKMSVLQSQRVVTSTQSNPDDILTLSSSTESEGESGTSRKPTAGHTSATAVDSDDIQTISSGSDGDDFEDKKNLSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL 326AED6371D156C2 ltor3_mouse Ragulator complex protein LAMTOR3 Map2k1ip1 Mitogen-activated protein kinase kinase 1-interacting protein 1 Lamtor3 Mapbp MEK-binding partner 1 Mapksp1 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3 Mitogen-activated protein kinase scaffold protein 1 protein protein mouse Mus musculus Mouse MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEVS 3B9C8A0241D806A9 hmga1_mouse High mobility group protein HMG-I/HMG-Y High mobility group AT-hook protein 1 Hmga1 Hmgi Hmgiy protein protein mouse Mus musculus Mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ 4EC39386611959FC h2ay_mouse Core histone macro-H2A.1 Macroh2a1 H2A.y H2A/y H2afy protein protein mouse Mus musculus Mouse MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVAKKTGGKKGARKSKKKQGEVSKAASADSTTEGTPTDGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAISAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFMLFDSESIGIYVQEMAKLDAN 076CF76A34FACAA0 sap18_drome Histone deacetylase complex subunit SAP18 Bin1 SAP18 CG6046 18 kDa Sin3-associated polypeptide Bicoid-interacting protein 1 dSAP18 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY 94947F206D8FA0AD sap18_mouse Histone deacetylase complex subunit SAP18 Sap18 18 kDa Sin3-associated polypeptide Sin3-associated polypeptide p18 protein protein mouse Mus musculus Mouse MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY DIP protein O55128 original sequence version: 90 68FE63E6EAD04E6F sufu-ci 3 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association sufu-gli1 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 sufu-leg3 3 16 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 su_fu_-ci-3 3 20 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig. 4 ci-g9vg38 3 20 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 4 fu-ci-1 3 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig. 4 cos-fu-3 3 14 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey physical association physical association Fig. 4 leg3-leg3 3 16 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig. 4 ncoa3-fu 3 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 rn19a-sufu 3 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association Fig. 4 zfp219-zfp219 3 18 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-bin1-1 3 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 sap18-h2ay 3 21 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Fig. 4 sap18-sufu-1 6 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5A sufu-leg3 2 7 unspecified role unspecified role bait bait tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 5B leg3-sufu 4 16 unspecified role unspecified role neutral component neutral component his6/xpress tagged tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Upon co-transfection, nuclear leg3 level decreased and proteins accumulated in cytoplasm where it colocalized with sufu in 61% of double-labelled cells. LMB treatment blocks the effect of sufu on the cytoplasmic localization of leg3. Fig. 6H sap18-sufu-2 4 27 unspecified role unspecified role neutral component neutral component his6/xpress tagged tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Upon co-transfection, sufu translocated to the nucleus and colocalized with sap18 in 67% of cells. Fig. 6J sufu-gli3 3 17 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 sufu-sufu-2 3 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 sufu-ncoa3 3 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association sufu-sap18-1 3 19 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association sufu-setdb1 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 22 unspecified role unspecified role prey prey physical association physical association Fig. 4 sufu-rn19a 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 sufu-sap18-1 3 7 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-3509188]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 326-326, sequence length 153 [EBI-3509188]326-484 physical association physical association Fig. 4 sufu-hmga1 3 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role prey prey physical association physical association Fig. 4 sufu-sap18-2 1 7 unspecified role unspecified role bait bait tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 5A sufu-cebpz 3 15 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association sufu-cebpz-1 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-leg3-1 5 16 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-sap18-3 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role prey prey physical association physical association Table 1. sufu-ncoa3-1 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-hnrnpa1 5 19 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-rn19a-1 5 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-setdb1-1 5 22 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-q924s6 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-pias1 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role prey prey physical association physical association Table 1. sufu-h2ay 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-hmga1-1 5 24 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-prdx6 5 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-mapksp1 5 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 23 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. sufu-prdx6-1 3 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association Fig. 4 sufu-mapksp1-1 3 23 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 sufu-pias1-1 3 21 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Fig. 4 sufu-fu 3 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association sufu-bin1-1 3 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 26 unspecified role unspecified role prey prey physical association physical association su_fu_-gli1 3 8 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig. 4 su_fu_-pias1 3 20 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Fig. 4 su_fu_-fu-1 3 20 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Fig. 4 fu-ci 3 13 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Fig. 4 cos-q924s6 3 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 cos-pias1 3 21 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association leg3-sufu-1 3 16 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 ncoa3-gli1 3 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 ncoa3-1 3 10 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 4 ncoa3-roa1 3 19 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 ncoa3-rnf19a 3 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 ncoa3-setb1 3 22 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 ncoa3-znf219 3 10 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig. 4 ncoa3-leg3 3 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 ncoa3-sap18 3 10 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association Fig. 4 ncoa3-prdx6 3 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey physical association physical association Fig. 4 ncoa3-mp1 3 23 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 ncoa3-pias1 3 21 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 4 rn19a-pias1-1 3 9 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Fig. 4 sap18-sufu 3 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role bait bait physical association physical association Fig. 4 sap18-hmga1 3 24 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-gli1 3 21 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 4 pias1-gli3 3 17 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-ncoa3 3 21 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 4 pias1-hnrnpa1 3 19 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association pias1-setdb1 3 22 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-q924s6 3 18 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-leg3 3 16 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-sap18 3 27 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-mapksp1 3 23 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-ci 3 12 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-bin1-2 3 26 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Fig. 4 pias1-su_fu_ 3 21 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Fig. 4