MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Lowe syndrome protein OCRL1 interacts with Rac GTPase in the trans-Golgi network. Lowe syndrome protein OCRL1 interacts with Rac GTPase in the trans-Golgi network. Hum. Mol. Genet. (0964-6906) 2003 Faucherre A., Desbois P., Satre V., Lunardi J., Dorseuil O., Gacon G. suggested by apalma chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey pull down pull down predetermined predetermined participant predetermined Faucherre A., Desbois P., Satre V., Lunardi J., Dorseuil O., Gacon G. suggested by apalma Hum. Mol. Genet. (0964-6906) 2003 Lowe syndrome protein OCRL1 interacts with Rac GTPase in the trans-Golgi network. Lowe syndrome protein OCRL1 interacts with Rac GTPase in the trans-Golgi network. Hum. Mol. Genet. (0964-6906) 2003 Faucherre A., Desbois P., Satre V., Lunardi J., Dorseuil O., Gacon G. suggested by apalma chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Faucherre A., Desbois P., Satre V., Lunardi J., Dorseuil O., Gacon G. suggested by apalma Hum. Mol. Genet. (0964-6906) 2003 Lowe syndrome protein OCRL1 interacts with Rac GTPase in the trans-Golgi network. Lowe syndrome protein OCRL1 interacts with Rac GTPase in the trans-Golgi network. Hum. Mol. Genet. (0964-6906) 2003 Faucherre A., Desbois P., Satre V., Lunardi J., Dorseuil O., Gacon G. suggested by apalma human Homo sapiens Human fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Faucherre A., Desbois P., Satre V., Lunardi J., Dorseuil O., Gacon G. suggested by apalma Hum. Mol. Genet. (0964-6906) 2003 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 ocrl_human Inositol polyphosphate 5-phosphatase OCRL Inositol polyphosphate 5-phosphatase OCRL-1 Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase OCRL Lowe oculocerebrorenal syndrome protein OCRL1 protein protein human Homo sapiens Human MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQTFRFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWLGDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLMAFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED 476BFCCC3655C1FE ocrl-rac1 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint fig.1 ocrl-rac1-1 3 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization homomint mint fig.2 ocrl-rac1-2 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association homomint mint fig.3