UniProt UniProt http://www.uniprot.org Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de Accepted 2011-OCT-18 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de Accepted 2011-OCT-18 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de Accepted 2011-OCT-18 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de Accepted 2011-OCT-18 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. tried to contact the author for the species origin but e-mail adress does not work Used cytoplasmic tail constructs of following p24 proteins have been mapped to rat origin as mammalian sequences are identical and interacting partners are of rat origin: TMP21/p24delta1/TMED1, p24a/p24beta1/TMED2, gp25L/p24alpha2TMED9 and gp27/p24gamma3/TMED7. Experiments using the cytoplasmic tail of the following proteins are omitted as their origin could not be established from the publication and mammalian proteins are differing in the respective region: p24b/p24gamma4/TMED3, ST2/TMED1/p24gamma1 and p24b/TMED3/p24gamma4; TGF-alpha and GM130 (C-terminus). Range of p24 cytoplasmic tails according UniProt. barr@biochem.mpg.de Accepted 2011-OCT-18 by JYOTI J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation tmed2_rat Transmembrane emp24 domain-containing protein 2 RNP21.4 Tmed2 Rnp24 Membrane protein p24A p24 family protein beta-1 COPI-coated vesicle membrane protein p24 protein protein rat Rattus norvegicus (Rat) Rat MVTLAELLVLLAALLATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV E35A3816429DDF9A goga2_rat Golgin subfamily A member 2 Golga2 130 kDa cis-Golgi matrix protein protein protein rat Rattus norvegicus (Rat) Rat MWPPRFPPPRPGMSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKKKIKNGHSPERTSASDCQSAENVPTDHTAPAPPSTAAATMFLGVVPSPDADLIQSHDAGNCSNLMEETKTFSSTESLRQLSQQLNGLVSESTSYINGEGLTSSNMKELESRYQELAVALDSSYVTNKQLSSTIEELKQQNQDTLDQLEKEKKDYQQKLAKEQGALREQLQVHIQTIGILVSEKAELQTALAHTQQAARQKAGESEDLASRLQSSRQRVGELERTLSTVSTQQKQADRYNKDLTKERDALKLELYKNGKSNEDLRQQNSELEEKLRVLVAEKAAAQLGAEELQKKLEMSELLLQQFSSQSEASGSNEQLQQAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHALKEEKEQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLTGQLRAQVQDNESLSHLNREQEGRLLELEREAQHWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLTNENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQQYAAAYQQHLTAYEQLTSEKEALHKQLLLQTQLMDQLQHEEVQGKMAAEMARQELQEAQERLKASSQENQQLQAQLSLLVLPGEDMDQEEQDEEVPQPSLTIPEDLVSREAMVAFCNAAIARAEEEQARLRVQLREQKARCRSLAHLAAPVQSKLEKEAVVPRDMGDSVSEESNQALHVAMEKLQNRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPADVPAPVPTGSQEFGAADQQGDLREVSLADDTEPAQGEAGVPAPQENPTAQQIMQLLREIQNPQERPGLGSNPCIPFFYRADENDEVKIMVI 3AA8CBC61F98A6A4 gors1_rat Golgi reassembly-stacking protein 1 Gorasp1 Grasp65 Golgi peripheral membrane protein p65 Golgi reassembly-stacking protein of 65 kDa protein protein rat Rattus norvegicus (Rat) Rat MGLGASSEQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPSSPAALAGLRPYTDYIVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPSSQYKKPPSASSPGTPAKTPQPNAFPLGAPPPWPIPQDSSGPELGSRQSDYMEALPQVPGGFMEEQLPGPGSPGHGTADYGGCLHSMEIPLQPPPPVQRVMDPGFLDVSGMSLLDSNNTSVCPSLSSSSLLTPTAVSALGPEDIGSSSSSHERGGEATWSGSEFEISFPDSPGSQAQVDHLPRLTLPDGLTSAASPEEGLSAELLEAQTEEPAHTASLDCMAQTEGPAGQVQAAPDPEPGLCEGPW DIP protein O35254 original sequence version: 69 5B38FADF2E255EA3 go45_rat Golgin-45 Basic leucine zipper nuclear factor 1 Blzf1 protein protein rat Rattus norvegicus (Rat) Rat MEKMTTLKSFESKGILTSTPIRGAGDGMETEEPPKSVEVTHGVQPINQHVLPSPRKKVPSDSPGVLQLGKILNEKTVEVEAVRIFVPKAAITHDIPTKSAKVKSLGHHREELHNQSEVVTDPRKELSEVKKVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDPQYHFERLAREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMADELTNFRVVLQHQNRDAQSAIQDLLSEREQFRQEMISTQKFLEELLVSLQWGREQTYSPNTQPHSTADLALTNHRLAEAVHAHLLGNVGISHPKRTPATAEVCSTPAEKMAEKVLRILDPVACTESSPDNAFAESTLLTTKKNIGRFHPYTRYENITFNCCSHCQGELLAL F5AABB4D0D52E307 tmed9_rat Transmembrane emp24 domain-containing protein 9 Tmed9 p24 family protein alpha-2 protein protein rat Rattus norvegicus (Rat) Rat MAAVRGVRVVGTSPGLLLGRGMRAFLLLLCLAARGGALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV 32F0D1DCC9EFBA6E tmeda_rat Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmed10 Tmp21 p24 family protein delta-1 protein protein rat Rattus norvegicus (Rat) Rat MSGLSGPLSWPGPLLSALLFLFLLGPSSVLGISFHLPVNSRKCLREEIHKDLLVTGAYEITDQSGGAGGLRTHLKITDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE 51FC99ECB6D47ADE tmed7_rat Transmembrane emp24 domain-containing protein 7 Tmed7 p27 p24 family protein gamma-3 protein protein rat Rattus norvegicus (Rat) Rat MPRPRSATCWAAAAGRWSCRLLALLLLLLLPGPSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS 88DF436F6A4A5A6A gors2_rat Golgi reassembly-stacking protein 2 Gorasp2 Golgi reassembly-stacking protein of 55 kDa protein protein rat Rattus norvegicus (Rat) Rat MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSISGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEGKKISLPGQMTGTPITPLKDGFTQVQLSSVSPPSLSPPGTAGVEQSLSGLSISSAPPAVSNVLSTGVPTVPLLPPQVNQSLASVPPMNPAATLPSLMPLSAGLPNLPNLPSLSNFNLPAPHIMPGVGLPELGKPGLPPLPSLPPRNVPGIAPLPMPSDFLPSFPLVPEGSSAASAGEPLSSLPAMGPPSDPVMTTAKADTSSLTVDVMSPASKVPTTVEDRVSDCTPAMEKPVSAVTDANASGAS BB6898C85CB6221C gorasp2-blzf1 5 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey physical association physical association 1A gorasp2-tmed2 3 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 1B gorasp2-tmed2-1 3 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 1B gorasp1-tmed2 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1B gorasp1-tmed2-1 3 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1B golga2-tmed2 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1B tmed2-gorasp2 1 6 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain VV AA Thu Jul 07 12:06:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val200ala-val201ala Fri Jul 22 11:13:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val200ala,val201ala' Wed May 02 19:27:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_val200-201ala_ala' Tue Jun 30 16:19:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val200_Val201delinsAlaAla' 13 unspecified role unspecified role prey prey physical association physical association 2A and 3B Oligomerized p24 protein is necessary for the interaction tmed2-gorasp1 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain VV AA Thu Jul 07 12:06:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val200ala-val201ala Fri Jul 22 11:10:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val200ala,val201ala' Wed May 02 20:05:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_val200-201ala_ala' Tue Jun 30 16:09:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val200_Val201delinsAlaAla' c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2B and 3A Oligomerized p24 protein is necessary for the interaction tmed10-gorasp2 2 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 2D tmed10-tmed2-7 2 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain VV AA Thu Jul 07 12:06:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val200ala-val201ala Fri Jul 22 10:55:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val200ala,val201ala' Wed May 02 15:50:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_val200-201ala_ala' Tue Jun 30 16:35:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val200_Val201delinsAlaAla' direct interaction direct interaction 2D and 3A tmed2-tmed7 2 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 2D tmed7-tmed9 2 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 2D tmed2-gorasp1-1 4 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q63524:p.Val200_Val201delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain VV AA Thu Jul 07 12:07:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val200ala-val201ala Fri Jul 22 10:57:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val200ala,val201ala' Wed May 02 18:47:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_val200-201ala_ala' Tue Jun 30 19:17:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val200_Val201delinsAlaAla' 8 unspecified role unspecified role prey prey direct interaction direct interaction 2D and 3B