UniProt UniProt http://www.uniprot.org A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Human testis cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Human testis cDNA J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Human testis cDNA Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Human testis cDNA J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Human testis cDNA Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Human testis cDNA J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Human testis cDNA Only protein-protein interactions rat-kidney Rat kidney kidney kidney [Renal] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Human testis cDNA J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Human testis cDNA Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Human testis cDNA J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. A GRASP55-rab2 effector complex linking Golgi structure to membrane traffic. J. Cell Biol. (0021-9525) 2001 imex curation Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de 21-Dec-2011: Contacted by JYOTI. Human testis cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Short B., Preisinger C., Korner R., Kopajtich R., Byron O., Barr F.A. Stated length of human golgi-45 differs from UniProt, hence no binding site annotated e-mail adress doesnot work (know it from related paper, pmid 11739402, hence makes no sense to ask for the constructs). Problems to differ or not the exp fig 2a (GDP vs GTP forms). Did combine if detected associated proteins are the same (just weaker signal, left a comment), separated the interactions if number of preys is different (rab2)).?makews sense? May be promote all to IMEx? Not sure, mainly because of the former problem. Directed Y2H experiments using Golgin-45, GM130 and p115 constructs are omitted as species origin of the proteins can not be established from the publication (fig 1A and 2B). In vitro CoIP experiments using transfected GM130 and GRASP65 constructs have been omitted for the same reason (fig 1B). barr@biochem.mpg.de Accepted 2011-OCT-28 by ORCHARD Human testis cDNA J. Cell Biol. (0021-9525) 2001 Only protein-protein interactions imex curation go45_mouse Golgin-45 Blzf1 Basic leucine zipper nuclear factor 1 protein protein mouse Mus musculus Mouse MEKMTTLKSSENKGILTSTPIRGAGDGMETEEPPKSVEVTHGVQPINQHVLPSPRKKVSSDSPGVLQLGKILNERTVEVEAVRIFVPKAAITHDIPTKNTKVKSLGHHREELHNQAEVVTDPRKELSEVKKVLEKLKNSERRLLQDKEGLSNQLRVQTEINRELKKLLVASVGDDPQYHFERLAREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMADELTNFRVVLQRQNRDAQSAIQDLLSEREQFRQEMTSTQKFLEELLVSLQWGREQTYSPNTQPHSTADLALTNHGLAQAIHAHLLGNVGISHQKKIPTTVEFCSTPAEKMAEKVLRILDPVACTESSPDNQFAESSPTTLLTTKKNIGRFHPYTRYENITFNCCNHCQGELIAL F87A9752AEEC3559 rab1a_human Ras-related protein Rab-1A YPT1-related protein RAB1A RAB1 protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC B2A8F4E3B0FB17D6 goga2_rat Golgin subfamily A member 2 Golga2 130 kDa cis-Golgi matrix protein protein protein rat Rattus norvegicus (Rat) Rat MWPPRFPPPRPGMSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKKKIKNGHSPERTSASDCQSAENVPTDHTAPAPPSTAAATMFLGVVPSPDADLIQSHDAGNCSNLMEETKTFSSTESLRQLSQQLNGLVSESTSYINGEGLTSSNMKELESRYQELAVALDSSYVTNKQLSSTIEELKQQNQDTLDQLEKEKKDYQQKLAKEQGALREQLQVHIQTIGILVSEKAELQTALAHTQQAARQKAGESEDLASRLQSSRQRVGELERTLSTVSTQQKQADRYNKDLTKERDALKLELYKNGKSNEDLRQQNSELEEKLRVLVAEKAAAQLGAEELQKKLEMSELLLQQFSSQSEASGSNEQLQQAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHALKEEKEQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLTGQLRAQVQDNESLSHLNREQEGRLLELEREAQHWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLTNENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQQYAAAYQQHLTAYEQLTSEKEALHKQLLLQTQLMDQLQHEEVQGKMAAEMARQELQEAQERLKASSQENQQLQAQLSLLVLPGEDMDQEEQDEEVPQPSLTIPEDLVSREAMVAFCNAAIARAEEEQARLRVQLREQKARCRSLAHLAAPVQSKLEKEAVVPRDMGDSVSEESNQALHVAMEKLQNRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPADVPAPVPTGSQEFGAADQQGDLREVSLADDTEPAQGEAGVPAPQENPTAQQIMQLLREIQNPQERPGLGSNPCIPFFYRADENDEVKIMVI 3AA8CBC61F98A6A4 goga2_human Golgin subfamily A member 2 GOLGA2 130 kDa cis-Golgi matrix protein GM130 autoantigen Golgin-95 protein protein human Homo sapiens Human MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLELYKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPDANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHTLREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLAGQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWHGRFLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTAQQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVKITVI BD067145C5092237 go45_rat Golgin-45 Basic leucine zipper nuclear factor 1 Blzf1 protein protein rat Rattus norvegicus (Rat) Rat MEKMTTLKSFESKGILTSTPIRGAGDGMETEEPPKSVEVTHGVQPINQHVLPSPRKKVPSDSPGVLQLGKILNEKTVEVEAVRIFVPKAAITHDIPTKSAKVKSLGHHREELHNQSEVVTDPRKELSEVKKVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDPQYHFERLAREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMADELTNFRVVLQHQNRDAQSAIQDLLSEREQFRQEMISTQKFLEELLVSLQWGREQTYSPNTQPHSTADLALTNHRLAEAVHAHLLGNVGISHPKRTPATAEVCSTPAEKMAEKVLRILDPVACTESSPDNAFAESTLLTTKKNIGRFHPYTRYENITFNCCSHCQGELLAL F5AABB4D0D52E307 gors2_rat Golgi reassembly-stacking protein 2 Gorasp2 Golgi reassembly-stacking protein of 55 kDa protein protein rat Rattus norvegicus (Rat) Rat MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSISGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEGKKISLPGQMTGTPITPLKDGFTQVQLSSVSPPSLSPPGTAGVEQSLSGLSISSAPPAVSNVLSTGVPTVPLLPPQVNQSLASVPPMNPAATLPSLMPLSAGLPNLPNLPSLSNFNLPAPHIMPGVGLPELGKPGLPPLPSLPPRNVPGIAPLPMPSDFLPSFPLVPEGSSAASAGEPLSSLPAMGPPSDPVMTTAKADTSSLTVDVMSPASKVPTTVEDRVSDCTPAMEKPVSAVTDANASGAS BB6898C85CB6221C uso1_rat General vesicular transport factor p115 Uso1 Vdp Protein USO1 homolog Transcytosis-associated protein Vesicle-docking protein protein protein rat Rattus norvegicus (Rat) Rat MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIAYALDTLYNIISNDEEEEVEENSTRQSEDLGSQFTEIFIKQPENVTLLLSLLEEFDFHVRWPGVRLLTSLLKQLGPPVQQIILVSPMGVSKLMDLLADSREIIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIITEEGNSDGGIVVEDCLILLQNLLKNNNSNQNFFKEGSYIQRMKAWFEVGDENPGWSAQKVTNLHLMLQLVRVLVSPTNPPGATSSCQKAMFQCGLLQQLCTILMATGIPADILTETINTVSEVIRGCQVNQDYFASVNAPSNPPRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNEKGQGEIVATLLPSTIDATGNSVSAGQLLCGGLFSTDSLSNWCAAVALAHALQGNATQKEQLLRVQLATSIGNPPVSLLQQCTNILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNSLENYTKEKLKQLIEKRIGKENYIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIREQDLQLEELKQQVSTLKCQNEQLQTAVTQQASQIQQHKDQYNLLKVQLGKDNHHQGSHSDGAQVNGIQPEEISRLREEIEELRSHQVLLQSQLAEKDTVIENLRSSQVSGMSEQALATCSPRDAEQVAELKQELSALKSQLCSQSLEITRLQTENSELQQRAETLAKSVPVEGESELVTAAKTTDVEGRLSALLQETKELKNEIKALSEERTAIQKQLDSSNSTIAILQTEKDKLYLEVTDSKKEQDDLLVLLADQDQKILSLKSKLKDLGHPVEEEDESGDQEDDDDELDDGDRDQDI 356394B48C7E003B go45_human Golgin-45 BLZF1 JEM1 Basic leucine zipper nuclear factor 1 JEM-1 p45 basic leucine-zipper nuclear factor protein protein human Homo sapiens Human MTTKNLETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVQSRKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEVKAVRILVPKAAITHDIPNKNTKVKSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLAREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMADELTNSRAALQRQNRDAHGAIQDLLSEREQFRQEMIATQKLLEELLVSLQWGREQTYSPSVQPHSTAELALTNHKLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL F3F9DA9B13DF45B5 gors1_rat Golgi reassembly-stacking protein 1 Gorasp1 Grasp65 Golgi peripheral membrane protein p65 Golgi reassembly-stacking protein of 65 kDa protein protein rat Rattus norvegicus (Rat) Rat MGLGASSEQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPSSPAALAGLRPYTDYIVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPSSQYKKPPSASSPGTPAKTPQPNAFPLGAPPPWPIPQDSSGPELGSRQSDYMEALPQVPGGFMEEQLPGPGSPGHGTADYGGCLHSMEIPLQPPPPVQRVMDPGFLDVSGMSLLDSNNTSVCPSLSSSSLLTPTAVSALGPEDIGSSSSSHERGGEATWSGSEFEISFPDSPGSQAQVDHLPRLTLPDGLTSAASPEEGLSAELLEAQTEEPAHTASLDCMAQTEGPAGQVQAAPDPEPGLCEGPW DIP protein O35254 original sequence version: 69 5B38FADF2E255EA3 rab2a_human Ras-related protein Rab-2A RAB2A RAB2 protein protein human Homo sapiens Human MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGGCC F8731E3F8FB399A3 gorasp2-golga2 6 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association no figure gorasp2-blzf1-1 6 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association no figure gorasp2-blzf1-2 3 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1C gorasp2-blzf1-3 5 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1E gorasp1-golga2 5 15 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 1E golga2-gorasp1 5 9 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association 1E blzf1-gorasp2-1 5 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 1E rab1a-golga2 2 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 9 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association 2A Strong interaction with GTP form of Rab1, weak interaction with GDP form of Rab1 rab2a-golga2 2 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 9 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver association association 2A Weak interaction with GDP form of Rab2 rab2a-blzf1 2 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association 2A Strong interaction with GTP form of Rab2 rab2a-blzf1-1 1 7 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait P61019:p.Gln65Leu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:42:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln65leu' Tue Jun 30 16:56:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln65Leu' physical association physical association 2B blzf1-rab2a 1 16 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 2C blzf1-gorasp2-2 1 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 2C blzf1-gorasp2-3 4 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 3A