MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Protein phosphatase 2A interacts with and directly dephosphorylates RelA. Protein phosphatase 2A interacts with and directly dephosphorylates RelA. J. Biol. Chem. (0021-9258) 2001 Yang J., Fan GH., Wadzinski BE., Sakurai H., Richmond A. suggested by panni ann.richmond@mcmail.vanderbilt.edu partial coverage rapid curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang J., Fan GH., Wadzinski BE., Sakurai H., Richmond A. suggested by panni ann.richmond@mcmail.vanderbilt.edu Accepted 2013-AUG-29 by ORCHARD J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation Protein phosphatase 2A interacts with and directly dephosphorylates RelA. Protein phosphatase 2A interacts with and directly dephosphorylates RelA. J. Biol. Chem. (0021-9258) 2001 Yang J., Fan GH., Wadzinski BE., Sakurai H., Richmond A. suggested by panni ann.richmond@mcmail.vanderbilt.edu partial coverage rapid curation in vitro In vitro phosphatase assay phosphatase assay autoradiography autoradiography Yang J., Fan GH., Wadzinski BE., Sakurai H., Richmond A. suggested by panni ann.richmond@mcmail.vanderbilt.edu Accepted 2013-AUG-29 by ORCHARD J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation Protein phosphatase 2A interacts with and directly dephosphorylates RelA. Protein phosphatase 2A interacts with and directly dephosphorylates RelA. J. Biol. Chem. (0021-9258) 2001 Yang J., Fan GH., Wadzinski BE., Sakurai H., Richmond A. suggested by panni ann.richmond@mcmail.vanderbilt.edu partial coverage rapid curation human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Yang J., Fan GH., Wadzinski BE., Sakurai H., Richmond A. suggested by panni ann.richmond@mcmail.vanderbilt.edu Accepted 2013-AUG-29 by ORCHARD J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 rela-ppp2ca-2 1 5 unspecified role unspecified role prey prey human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rhd sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes association association F2 homomint mint ppp2r1a-rela 1 4 unspecified role unspecified role prey prey human-sk_mel_5 Homo sapiens sk_mel_5 human sk-mel-5 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association F3 homomint mint rela-ppp2ca-1 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F4A homomint mint ppp2ca-rela 3 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association F4B homomint mint ppp2ca-rela-1 2 4 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 enzyme enzyme neutral component neutral component human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes dephosphorylation dephosphorylation reaction dephosphorylation Fig. 6 homomint mint P67775 is required for dephosphorylation of Q04206 ppp2ca-rela-2 2 6 enzyme enzyme neutral component neutral component human-sk_mel_5 Homo sapiens sk_mel_5 human sk-mel-5 4 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) dephosphorylation dephosphorylation reaction dephosphorylation Fig. 6 ppp2ca-rela-3 2 4 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 enzyme enzyme neutral component neutral component human-wm115 Human WM115 Melanoma cell line wm115 WM115 Human melanoma cell line http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-1675&Template=cellBiology dephosphorylation dephosphorylation reaction dephosphorylation Fig. 6