MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin. GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin. Oncogene (0950-9232) 2000 Ikeda S., Kishida M., Matsuura Y., Usui H., Kikuchi A. suggested by lperfetto partial coverage rapid curation in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Ikeda S., Kishida M., Matsuura Y., Usui H., Kikuchi A. suggested by lperfetto Oncogene (0950-9232) 2000 partial coverage rapid curation GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin. GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin. Oncogene (0950-9232) 2000 Ikeda S., Kishida M., Matsuura Y., Usui H., Kikuchi A. suggested by lperfetto partial coverage rapid curation chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ikeda S., Kishida M., Matsuura Y., Usui H., Kikuchi A. suggested by lperfetto Oncogene (0950-9232) 2000 partial coverage rapid curation GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin. GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin. Oncogene (0950-9232) 2000 Ikeda S., Kishida M., Matsuura Y., Usui H., Kikuchi A. suggested by lperfetto partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ikeda S., Kishida M., Matsuura Y., Usui H., Kikuchi A. suggested by lperfetto Oncogene (0950-9232) 2000 partial coverage rapid curation pp2ab_human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform PPP2CB protein protein human Homo sapiens Human MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P62714 original sequence version: 117 51DA9EB0633FC191 axin2_human Axin-2 AXIN2 Axin-like protein Axis inhibition protein 2 Conductin protein protein human Homo sapiens Human MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDSEISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPKEMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID DIP protein Q9Y2T1 original sequence version: 142 DIP protein Q9Y2T1 original sequence version: 110 F7B62BED6AB4664D axin2-ppp2cb 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint f5a f5b axin2-ppp2cb-1 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association f5c homomint mint axin2-ppp2cb-2 3 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey direct interaction direct interaction f5d homomint mint axin2-ppp2cb-3 1 4 enzyme enzyme neutral component neutral component 5 enzyme target enzyme target substrate substrate neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Resulting Phenotypic qualities (properties)[PATO]: PATO:0002263 (dephosphorylated) dephosphorylation dephosphorylation reaction dephosphorylation f6 homomint mint