IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ In vitro assembly of an archaeal D-L-N RNA polymerase subunit complex reveals a eukaryote-like structural arrangement. In vitro assembly of an archaeal D-L-N RNA polymerase subunit complex reveals a eukaryote-like structural arrangement. Nucleic Acids Res. (0305-1048) 1998 imex curation Eloranta JJ., Kato A., Teng MS., Weinzierl RO. Archaea - Interaction dataset based on Archaea proteins r.wienzierl@ic.ac.uk 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Eloranta JJ., Kato A., Teng MS., Weinzierl RO. Archaea - Interaction dataset based on Archaea proteins Subunits initially purifeid by pulldown, with GST-RPAD as bait. GST tag cleaved off, and complex further purified by size exclusion chromatography on a Sephacryl S-100 column. r.wienzierl@ic.ac.uk Accepted 2010-MAY-15 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 1998 orchard Only protein-protein interactions imex curation In vitro assembly of an archaeal D-L-N RNA polymerase subunit complex reveals a eukaryote-like structural arrangement. In vitro assembly of an archaeal D-L-N RNA polymerase subunit complex reveals a eukaryote-like structural arrangement. Nucleic Acids Res. (0305-1048) 1998 imex curation Eloranta JJ., Kato A., Teng MS., Weinzierl RO. Archaea - Interaction dataset based on Archaea proteins r.wienzierl@ic.ac.uk 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions methanocaldococcus jannaschii Methanocaldococcus jannaschii Methanococcus jannaschii 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Eloranta JJ., Kato A., Teng MS., Weinzierl RO. Archaea - Interaction dataset based on Archaea proteins r.wienzierl@ic.ac.uk Accepted 2010-MAY-15 by ORCHARD. Nucleic Acids Res. (0305-1048) 1998 orchard Only protein-protein interactions imex curation rpo3_metja DNA-directed RNA polymerase subunit Rpo3 rpo3 DNA-directed RNA polymerase subunit D rpoD MJ0192 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MITIKEKRKTRIGEEFIFSLKAPISFSNAIRRIMISEVPTFAIEDVYIYENSSSMDDEILAHRLGLIPIKGKPLLENEVITFTLEKEGPCTVYSSDLKSENGEVAFKNIPIVKLGKGQRIQIECEAIPGIGKVHAKWQPCNAVYKQIADDEVEFFVETFGQMEAEEILEEAVKILKNKAESFLQQLEMIEQ 3F5B96CA0D242A96 rpo11_metja DNA-directed RNA polymerase subunit Rpo11 rpo11 DNA-directed RNA polymerase subunit L rpoL MJ0387 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MEIKILERKDNLVEIELINEDHSLPNLLKDILLTKEGVKMASYSIDHPLLHPETGRYISNPKITIITEEGTDPLEVLKEGLRDIIKMCDTLLDELKEKK 0C25307DDF5EE909 rpb11_yeast DNA-directed RNA polymerase II subunit RPB11 YOL005C RPB11 DNA-directed RNA polymerase II 13.6 kDa polypeptide B13.6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF A98D109C5FF8E356 A98D109C5FF8E356 rpac2_yeast DNA-directed RNA polymerases I and III subunit RPAC2 YNL113W N1937 RPC19 DNA-directed RNA polymerases I and III 16 kDa polypeptide RPA19 AC19 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM 0B048299A787EEDB 0B048299A787EEDB rpod-rpol 2 3 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 2 rpol-rpod 2 3 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 2 rpod-rbp11 2 3 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 4 rbp11-rpod 2 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 4 rpod-rpac2 2 3 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey physical association physical association Fig. 4 rpod 1 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig. 3, 5 and 6 rpod-rpac2-1 2 3 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait physical association physical association Fig. 4