IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J. Biol. Chem. (0021-9258) 1997 imex curation Meyer HA., Hartmann E. Digitonin extracts of yeast cells were purified by sequential affinity chromatography including concanavalin A-Sepharose. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meyer HA., Hartmann E. Digitonin extracts of yeast cells were purified by sequential affinity chromatography including concanavalin A-Sepharose. Accepted 2010-MAY-21 by JYOTI. J. Biol. Chem. (0021-9258) 1997 jyoti Only protein-protein interactions imex curation The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J. Biol. Chem. (0021-9258) 1997 imex curation Meyer HA., Hartmann E. Digitonin extracts of yeast cells were purified by sequential affinity chromatography including concanavalin A-Sepharose. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Meyer HA., Hartmann E. Digitonin extracts of yeast cells were purified by sequential affinity chromatography including concanavalin A-Sepharose. Accepted 2010-MAY-21 by JYOTI. J. Biol. Chem. (0021-9258) 1997 jyoti Only protein-protein interactions imex curation The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J. Biol. Chem. (0021-9258) 1997 imex curation Meyer HA., Hartmann E. Digitonin extracts of yeast cells were purified by sequential affinity chromatography including concanavalin A-Sepharose. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast biochemical biochemical predetermined featur predetermined feature Meyer HA., Hartmann E. Digitonin extracts of yeast cells were purified by sequential affinity chromatography including concanavalin A-Sepharose. Accepted 2010-MAY-21 by JYOTI. J. Biol. Chem. (0021-9258) 1997 jyoti Only protein-protein interactions imex curation sec11_yeast Signal peptidase complex catalytic subunit SEC11 SEC11 Signal peptidase I Secretory protein 11 YIR022W protein protein yeast Saccharomyces cerevisiae Baker's yeast MNLRFELQKLLNVCFLFASAYMFWQGLAIATNSASPIVVVLSGSMEPAFQRGDILFLWNRNTFNQVGDVVVYEVEGKQIPIVHRVLRQHNNHADKQFLLTKGDNNAGNDISLYANKKIYLNKSKEIVGTVKGYFPQLGYITIWISENKYAKFALLGMLGLSALLGGE FC877232D6888DF3 spc1_yeast Signal peptidase complex subunit SPC1 SPC1 YJR010C-A YJR010BW Microsomal signal peptidase subunit 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD 814D7C7A49F49D6D spc2_yeast Signal peptidase complex subunit SPC2 YML055W YM9958.07 SPC2 SPY1 Microsomal signal peptidase subunit 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSAKPINVYSIPELNQALDEALPSVFARLNYERSYALLDAKLYIGYSIAVVAGLSFFLDKKFERDQIVTYQKLLVGAYFVLSLLFWYFSRFIEKGTVYVGKRRGTKEEIYVKTKFEKNEPLYLVELVQKKKGENSKKELKAKLEVNKVFNESGYLQNDAYFKWFSEQHNVLDTKKNE 432742B2E1E5382C spc3_yeast Signal peptidase complex subunit SPC3 SPC3 YLR066W L2186 Microsomal signal peptidase subunit 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSFVQRFQNVSNQAFSMGIVMVVFIMASSYYQLINNNAFSVPSNIDNVKTLINVRTSRYFGSQRGKAKENMKIKFDLNTDLTPLFNWNTKQVFVYLTAEYNSTEKITSEVTFWDKIIKSKDDAVIDVNDLRSKYSIWDIEDGKFEGKDLVFKLHWNVQPWVGLLTYGETVGNYTLTVENKNKV C6F30CC6C21C8C20 spc1-spc2-1 2 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Antibodies raised against the luminal part of Spc3p recognize a protein on Western blots that co-purifies with the already known yeast SPC subunits, Sec11p, Spc1p, and Spc2p (Fig.2 A). Fig. 2A spc1-spc2-2 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association we performed immunoprecipitation experiments with anti-Spc1p antibodies using yeast membranes solubilized in digitonin as starting material. The analysis of the precipitates by immunoblotting showed that under these conditions, Spc2p, Sec11p, and Spc3p are co-precipitated Fig. 2C spc1-spc2-3 3 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 2B Identity of SPC3 was confirmed by Edman digestion.