MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Regulation of mitochondrial phospholipids by Ups1/PRELI-like proteins depends on proteolysis and Mdm35. Regulation of mitochondrial phospholipids by Ups1/PRELI-like proteins depends on proteolysis and Mdm35. EMBO J. (0261-4189) 2010 imex curation Potting C., Wilmes C., Engmann T., Osman C., Langer T. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Potting C., Wilmes C., Engmann T., Osman C., Langer T. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation Regulation of mitochondrial phospholipids by Ups1/PRELI-like proteins depends on proteolysis and Mdm35. Regulation of mitochondrial phospholipids by Ups1/PRELI-like proteins depends on proteolysis and Mdm35. EMBO J. (0261-4189) 2010 imex curation Potting C., Wilmes C., Engmann T., Osman C., Langer T. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Potting C., Wilmes C., Engmann T., Osman C., Langer T. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation ups1_yeast Protein UPS1, mitochondrial YLR193C Unprocessed MGM1 protein 1 UPS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLLHKSTHIFPTDFASVSRAFFNRYPNPYSPHVLSIDTISRNVDQEGNLRTTRLLKKSGKLPTWVKPFLRGITETWIIEVSVVNPANSTMKTYTRNLDHTGIMKVEEYTTYQFDSATSSTIADSRVKFSSGFNMGIKSKVEDWSRTKFDENVKKSRMGMAFVIQKLEEARNPQF 5B9003B6A2323109 ups2_yeast Protein UPS2, mitochondrial UPS2 YLR168C L9470.15 MSF1 Altered inheritance rate of mitochondrion protein 30 AIM30 Genetic interactor of prohibitins protein 1 Unprocessed MGM1 protein 2 GEP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLFQNSYDFNYPWDQVTAANWKKYPNEISTHVIAVDVLRRELKDQGKVLVTERLITVKQGVPKWIMMMLGGTNMSHVREVSVVDLNKKSLTMRSCNLTMCNLLKVYETVTYSPHPDDSANKTLFQQEAQITAYGSIRKLCNKMEDWSVQRFCENAKKGKMGFDAVLQVFSENWEKHVDDLSNQLVSKVNETMEDVKISAGTLLKGTERSGRTILQQNIDLFRDAYNHEN D4A2A5015EFB6570 mdm35_yeast Mitochondrial distribution and morphology protein 35 MDM35 YKL053C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQGIKPALDEAREEAPFENGGKLKEVDK 3DFEA08927BB8D10 ups1-mdm35 1 MDM35 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level UPS1 3 weight silver stain molecular weight estimation by silver staining weight silver stain predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a homomint mint ups2-mdm35 1 UPS2 4 weight silver stain molecular weight estimation by silver staining weight silver stain predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MDM35 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1a mint ups1-mdm35-1 2 UPS1 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MDM35 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c homomint mint ups2-mdm35-1 2 UPS2 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MDM35 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1b mint