MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The structural plasticity of SCA7 domains defines their differential nucleosome-binding properties. The structural plasticity of SCA7 domains defines their differential nucleosome-binding properties. EMBO Rep. (1469-221X) 2010 imex curation Bonnet J., Wang YH., Spedale G., Atkinson RA., Romier C., Hamiche A., Pijnappel WW., Timmers HT., Tora L., Devys D., Kieffer B. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bonnet J., Wang YH., Spedale G., Atkinson RA., Romier C., Hamiche A., Pijnappel WW., Timmers HT., Tora L., Devys D., Kieffer B. EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation The structural plasticity of SCA7 domains defines their differential nucleosome-binding properties. The structural plasticity of SCA7 domains defines their differential nucleosome-binding properties. EMBO Rep. (1469-221X) 2010 imex curation Bonnet J., Wang YH., Spedale G., Atkinson RA., Romier C., Hamiche A., Pijnappel WW., Timmers HT., Tora L., Devys D., Kieffer B. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Bonnet J., Wang YH., Spedale G., Atkinson RA., Romier C., Hamiche A., Pijnappel WW., Timmers HT., Tora L., Devys D., Kieffer B. EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation h3_drome Histone H3 His3 His3:CG31613 His3:CG33857 His3:CG33860 His3:CG33863 His3:CG33866 CG31613 CG33803 CG33806 CG33809 CG33812 CG33815 CG33818 CG33821 CG33824 CG33827 CG33830 CG33833 CG33836 CG33839 CG33842 CG33845 CG33848 CG33851 CG33854 CG33857 CG33860 CG33863 CG33866 His3:CG33803 His3:CG33806 His3:CG33809 His3:CG33812 His3:CG33815 His3:CG33818 His3:CG33821 His3:CG33824 His3:CG33827 His3:CG33830 His3:CG33833 His3:CG33836 His3:CG33839 His3:CG33842 His3:CG33845 His3:CG33848 His3:CG33851 His3:CG33854 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P02299 original sequence version: 100 6FD8508EA50A0EEC h2b_drome Histone H2B His2B His2B:CG17949 His2B:CG33868 His2B:CG33870 His2B:CG33872 His2B:CG33874 His2B:CG33876 His2B:CG33878 His2B:CG33880 His2B:CG33882 His2B:CG33884 His2B:CG33886 His2B:CG33888 His2B:CG33890 His2B:CG33892 His2B:CG33894 His2B:CG33896 His2B:CG33898 His2B:CG33900 His2B:CG33902 His2B:CG33904 His2B:CG33906 His2B:CG33908 His2B:CG33910 CG17949 CG33868 CG33870 CG33872 CG33874 CG33876 CG33878 CG33880 CG33882 CG33884 CG33886 CG33888 CG33890 CG33892 CG33894 CG33896 CG33898 CG33900 CG33902 CG33904 CG33906 CG33908 CG33910 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK DIP protein P02283 original sequence version: 88 0774D25F34003062 sgf73_yeast SAGA-associated factor 73 YGL066W SGF73 73 kDa SAGA-associated factor SAGA histone acetyltransferase complex 73 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSGDAEIKGIKPKVIEEYSLSQGSGPSNDSWKSLMSSAKDTPLQYDHMNRESLKKYFNPNAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLENHCAGASGKSSTDPRDESTRETIRNGVESTGRNNNDDDNSNDNNNDDDDDDDNDDNEDDDDADDDDDNSNGANYKKNDSSFNPLKRSTSMESANTPNMDTKRSKTGTPQTFSSSIKKQKKVKQRNPTEKHLIDFNKQCGVELPEGGYCARSLTCKSHSMGAKRAVSGRSKPYDVLLADYHREHQTKIGAAAEKRAKQQELQKLQKQIQKEQKKHTQQQKQGQRSKQRNVNGGKSAKNGGKSTVHNGNNINEIGHVNLTPEEETTQVLNGVSRSFPLPLESTVLSSVRYRTKYFRMREMFASSFSVKPGYTSPGYGAIHSRVGCLDLDRTTDYKFRVRTPQPINHLTNQNLNPKQIQRLQQQRALQAQLLSQQQQQQQQQQQHHSPQAQAQASTQQPTQGMVPNHFPGGATNSSFNANVSSKQIQQQQQQQQHKSQDTGLTPLEIQSQQQKLRQQQLQQQKFEAAASYLANATKLMQESNQDSHLSGTHNNNSSKNGNNNLMTMKASISSPNTSVNSIQSPPSVNSVNGSGQGVSTGINVSGNNGRIEVGIGNSVNPYNGRIN 4618E2E47824321D 4618E2E47824321D spt20_yeast Transcription factor SPT20 SPT20 ADA5 YOL148C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSANSPTGNDPHVFGIPVNATPSNMGSPGSPVNVPPPMNPAVANVNHPVMRTNSNSNANEGTRTLTREQIQQLQQRQRLLLQQRLLEQQRKQQALQNYEAQFYQMLMTLNKRPKRLYNFVEDADSILKKYEQYLHSFEFHIYENNYKICAPANSRLQQQQKQPELTSDGLILTKNNETLKEFLEYVARGRIPDAIMEVLRDCNIQFYEGNLILQVYDHTNTVDVTPKENKPNLNSSSSPSNNNSTQDNSKIQQPSEPNSGVANTGANTANKKASFKRPRVYRTLLKPNDLTTYYDMMSYADNARFSDSIYQQFESEILTLTKRNLSLSVPLNPYEHRDMLEETAFSEPHWDSEKKSFIHEHRAESTREGTKGVVGHIEERDEFPQHSSNYEQLMLIMNERTTTITNSTFAVSLTKNAMEIASSSSNGVRGASSSTSNSASNTRNNSLANGNQVALAAAAAAAAVGSTMGNDNNQFSRLKFIEQWRINKEKRKQQALSANINPTPFNARISMTAPLTPQQQLLQRQQQALEQQQNGGAMKNANKRSGNNATSNNNNNNNNLDKPKVKRPRKNAKKSESGTPAPKKKRMTKKKQSASSTPSSTTMS 3D67937B65F9AA6A 3D67937B65F9AA6A atx7_human Ataxin-7 Spinocerebellar ataxia type 7 protein ATXN7 SCA7 protein protein human Homo sapiens Human MSERAADDVRGEPRRAAAAAGGAAAAAARQQQQQQQQQQPPPPQPQRQQHPPPPPRRTRPEDGGPGAASTSAAAMATVGERRPLPSPEVMLGQSWNLWVEASKLPGKDGTELDESFKEFGKNREVMGLCREDMPIFGFCPAHDDFYLVVCNDCNQVVKPQAFQSHYERRHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGGVLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPATVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKRLSEREFDPDIHCGVIDLDTKKPCTRSLTCKTHSLTQRRAVQGRRKRFDVLLAEHKNKTREKELIRHPDSQQPPQPLRDPHPAPPRTSQEPHQNPHGVIPSESKPFVASKPKPHTPSLPRPPGCPAQQGGSAPIDPPPVHESPHPPLPATEPASRLSSEEGEGDDKEESVEKLDCHYSGHHPQPASFCTFGSRQIGRGYYVFDSRWNRLRCALNLMVEKHLNAQLWKKIPPVPSTTSPISTRIPHRTNSVPTSQCGVSYLAAATVSTSPVLLSSTCISPNSKSVPAHGTTLNAQPAASGAMDPVCSMQSRQVSSSSSSPSTPSGLSSVPSSPMSRKPQKLKSSKSLRPKESSGNSTNCQNASSSTSGGSGKKRKNSSPLLVHSSSSSSSSSSSSHSMESFRKNCVAHSGPPYPSTVTSSHSIGLNCVTNKANAVNVRHDQSGRGPPTGSPAESIKRMSVMVNSSDSTLSLGPFIHQSNELPVNSHGSFSHSHTPLDKLIGKKRKCSPSSSSINNSSSKPTKVAKVPAVNNVHMKHTGTIPGAQGLMNSSLLHQPKARP 9AEA787D77103C5F sgf73-his2b 1 H2B 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified H3 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified sgf73 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f3b mint atxn7-his2b 1 H3 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified H2B 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified ATXN7 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified O15265:p.Arg379Leu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R L Tue Jul 12 10:59:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:31:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg379leu' Tue Jun 30 18:17:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg379Leu' O15265:p.Arg378Tyr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R Y Tue Jul 12 10:24:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:43:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg378tyr' Tue Jun 30 16:25:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg378Tyr' O15265:p.Gly377Ile mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G I Tue Jul 12 10:59:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:43:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly377ile' Tue Jun 30 16:26:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly377Ile' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain association association homomint mint f3b f3c atxn7-his2b-1 1 H2B 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified ATXN7 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f4a f4b spt20-sgf73-4 2 spt20 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sgf73 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mint