MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The archaeal exosome localizes to the membrane. The archaeal exosome localizes to the membrane. FEBS Lett. (0014-5793) 2010 imex curation Roppelt V., Hobel CF., Albers SV., Lassek C., Schwarz H., Klug G., Evguenieva-Hackenberg E. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Roppelt V., Hobel CF., Albers SV., Lassek C., Schwarz H., Klug G., Evguenieva-Hackenberg E. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation The archaeal exosome localizes to the membrane. The archaeal exosome localizes to the membrane. FEBS Lett. (0014-5793) 2010 imex curation Roppelt V., Hobel CF., Albers SV., Lassek C., Schwarz H., Klug G., Evguenieva-Hackenberg E. Only protein-protein interactions sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Roppelt V., Hobel CF., Albers SV., Lassek C., Schwarz H., Klug G., Evguenieva-Hackenberg E. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation The archaeal exosome localizes to the membrane. The archaeal exosome localizes to the membrane. FEBS Lett. (0014-5793) 2010 imex curation Roppelt V., Hobel CF., Albers SV., Lassek C., Schwarz H., Klug G., Evguenieva-Hackenberg E. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Roppelt V., Hobel CF., Albers SV., Lassek C., Schwarz H., Klug G., Evguenieva-Hackenberg E. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation dnag_sacs2 DNA primase DnaG dnaG C04_042 C05_030 SSO0079 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MSFQMKYDIRLRFEVEGIVEKTDVIGAIFGQTENLFGDEFDLRELQDKGRLGRIIVEVKTKGGKSEGEIIIPSNLDRIETALIAAMVESVDKVGPYNSKFELIEIEDIRAEKLKKIIERAKGILSSWSKEKSLDIKEVINEISSAVKVGEITEYGPERLPAGPDVDKDPNLIIVEGRADVINLLRYGYKNVIAVEGATSRIPETLINLSKMKKTVIAFLDGDHGGDLILKELLSNNVKIDFVARAPIGREVEELTGKEIAKALSNMMPLTQYLKKVQEAEQAIAKNVIAKEEKPIQSETTQQVVQITLPQNILEEIKKLPGTLEGVLYDNNWNLIEKVQVRDIIPKLEAYEDNKVAYIIFDGVITQRLLDLASQKNIKMIIGARIGGINKRPQNVDILTFTDIISS mint 26E5B615560C6EF1 slaa_sacs2 S-layer protein A slaA Surface layer large protein slp1 SSO0389 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MNKTLGLILTSVFLLSTLGIITGFVIPTQAANSNDAAIYTIPSVTSVSNTSNIVINLFFNATSNSTVGAQASAFNYGLAINYTLDAITFTVVLPSGTSYPLIKLNAKNFANYGYYDLAHNSIVLLLNTTASSTAKELAYSYEQSIGVTPSASYKIYNYTNKTVNVNQYMNELPLSMLIYMATNGKYNNLASLPVGTKLEFTYAGVTYIIAVSPTVKLVGELLNPLYTANSKMLPGTNYAVGRSNITVAVYDNLITTTTSPFNFTLTYSSLAPALIYWFVIANTTYTNNGASTPTASFQAPPFKQYFPSNSTILYSAAPTKSSILMFNGQMNVTAHENVTLTLQTGTNIYTSPNFNVTPPGNYTFSGKLGVGFNGFIYQNGSATLTATIFNGTINFFFSSTGQKAAFTFFLVPIVPINLGDNNGATVIYNGVSLNTGFPQVVVMFNITGNFTKSGSNYLLYGSVYEAELKPLGSTQLQKLAGATDSTQFVGNLISSASSPLVSYFNYGESTTTITGTSLSFTVLMPLKFIVERLGYIYLVTFHIWGPSATVTVTGVDYHGTQIALGSFRAYVALPSFYTLPKTPLVGLTCDNMYTLAQVSDAGSVLETSTANSNANNATVIGPYDLMSNAGLHVAIYNGSKLVKSGNLGLLPNATTAPITTTITLNGQTVALTYSSAPTAIYPVDFKFEPGFSYSVTTNVIYNTSIPTYVVTVYMPLKYILQTKIVMWYVSPDYAAYFYYSSTGQYQTSNVTLTFANVTPELVMPQVFPVGKLYMPFGINDPYYVFYSSISIGPQSGVIEAVENGFNVGNITSITVELNGMNESIVLSPLNVSKLLISSNLGEVSQCSPLFTTTLFNISALASLLGLPNAAALNGSYLYVTYHDIISGAYVTNRTLLVVGQFYVMPPTTPGSVEWILTAKYINATTGIPVEISYAVVQQPSAKVVDINAANASITQIQVTGVKIVSKYATVTVMYNPSNASTIVYMNGMFVASYGGNLISSLSETSTFGVYYGAVVNLYVATGTLSSPNGTMYVVLGSHKVAVGTANLYTYAGYHFGPYTALPLVSNVTFTVQDPVTHATLTGQTTLGAFNNTPIRLAPLGVSIPQTAQYKVFYYYSTPLVLSPTSQYIVLSVTSVISYPYPFYIETVSFLGYNVTTGTPVPGTPAFQTVYSPSLGPGVVLQVPVQSYQFISLSTPSEPHTVVMFAVPFAGGPAISLYPTFLVYANVTAISS mint B85623012F8BCAEE rrp41_sacs2 Exosome complex component Rrp41 rrp41 SSO0735 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MREMLQVERPKLILDDGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRAVLRVRYHMTPFSTDERKNPAPSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKADGVIILDLNETEDMWGEADMPIAMMPSLNQVTLFQLNGSMTPDEFRQAFDLAVKGINIIYNLEREALKSKYVEFKEEGV DIP protein Q9UXC2 original sequence version: 73 mint EAB2C2C89DD5854C ecx1-y079 3 Rrp41 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level DnaG 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization sf1 mint ecx1-slp1 1 DnaG 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Rrp41 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level SlaA 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization mint f1 sf4 f2a f2c f2d ecx1-y079-1 2 Rrp41 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell DnaG 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3 mint