MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1. An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1. EMBO J. (0261-4189) 2010 imex curation Koyama M., Matsuura Y. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Koyama M., Matsuura Y. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1. An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1. EMBO J. (0261-4189) 2010 imex curation Koyama M., Matsuura Y. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Koyama M., Matsuura Y. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1. An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1. EMBO J. (0261-4189) 2010 imex curation Koyama M., Matsuura Y. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Koyama M., Matsuura Y. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation gsp1_yeast GTP-binding nuclear protein GSP1/CNR1 CNR1 CST17 GTPase Ran homolog L8003.19 YLR293C GSP1 Genetic suppressor of PRP20-1 Chromosome stability protein 17 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL C9D027033F8C70E1 C9D027033F8C70E1 xpo1_yeast Exportin-1 CRM1 KAP124 YGR218W G8514 XPO1 Chromosome region maintenance protein 1 Karyopherin-124 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGILDFSNDLDIALLDQVVSTFYQGSGVQQKQAQEILTKFQDNPDAWQKADQILQFSTNPQSKFIALSILDKLITRKWKLLPNDHRIGIRNFVVGMIISMCQDDEVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEEVFDFSAEQMTQAKALHLKNSMSKEFEQIFKLCFQVLEQGSSSSLIVATLESLLRYLHWIPYRYIYETNILELLSTKFMTSPDTRAITLKCLTEVSNLKIPQDNDLIKRQTVLFFQNTLQQIATSVMPVTADLKATYANANGNDQSFLQDLAMFLTTYLARNRALLESDESLRELLLNAHQYLIQLSKIEERELFKTTLDYWHNLVADLFYEVQRLPATEMSPLIQLSVGSQAISTGSGALNPEYMKRFPLKKHIYEEICSQLRLVIIENMVRPEEVLVVENDEGEIVREFVKESDTIQLYKSEREVLVYLTHLNVIDTEEIMISKLARQIDGSEWSWHNINTLSWAIGSISGTMSEDTEKRFVVTVIKDLLDLTVKKRGKDNKAVVASDIMYVVGQYPRFLKAHWNFLRTVILKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVIQQPRESEPFIQTIIRDIQKTTADLQPQQVHTFYKACGIIISEERSVAERNRLLSDLMQLPNMAWDTIVEQSTANPTLLLDSETVKIIANIIKTNVAVCTSMGADFYPQLGHIYYNMLQLYRAVSSMISAQVAAEGLIATKTPKVRGLRTIKKEILKLVETYISKARNLDDVVKVLVEPLLNAVLEDYMNNVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQSVFECTLDMINKDFTEYPEHRVEFYKLLKVINEKSFAAFLELPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLVKNIERMGNVPFANEFHKNYFFIFVSETFFVLTDSDHKSGFSKQALLLMKLISLVYDNKISVPLYQEAEVPQGTSNQVYLSQYLANMLSNAFPHLTSEQIASFLSALTKQYKDLVVFKGTLRDFLVQIKEVGGDPTDYLFAEDKENALMEQNRLEREKAAKIGGLLKPSELDD A81833C7F60F5202 A81833C7F60F5202 ipka_human cAMP-dependent protein kinase inhibitor alpha PRKACN1 cAMP-dependent protein kinase inhibitor, muscle/brain isoform PKIA protein protein human Homo sapiens Human MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES DIP protein P61925 original sequence version: 64 BDCE072810435951 xpo1_human Exportin-1 CRM1 XPO1 Chromosome region maintenance 1 protein homolog protein protein human Homo sapiens Human MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD DIP protein O14980 original sequence version: 98 DIP protein O14980 original sequence version: 120 DIP protein O14980 original sequence version: 97 DIP protein O14980 original sequence version: 96 DIP protein O14980 original sequence version: 116 DIP protein O14980 original sequence version: 129 DIP protein O14980 original sequence version: 130 FDB00C065DA2FB1D rna1_yeast Ran GTPase-activating protein 1 YM9959.17C RNA1 YMR235C Protein involved in RNA production/processing protein protein yeast Saccharomyces cerevisiae Baker's yeast MATLHFVPQHEEEQVYSISGKALKLTTSDDIKPYLEELAALKTCTKLDLSGNTIGTEASEALAKCIAENTQVRESLVEVNFADLYTSRLVDEVVDSLKFLLPVLLKCPHLEIVNLSDNAFGLRTIELLEDYIAHAVNIKHLILSNNGMGPFAGERIGKALFHLAQNKKAASKPFLETFICGRNRLENGSAVYLALGLKSHSEGLKVVKLYQNGIRPKGVATLIHYGLQYLKNLEILDLQDNTFTKHASLILAKALPTWKDSLFELNLNDCLLKTAGSDEVFKVFTEVKFPNLHVLKFEYNEMAQETIEVSFLPAMEKGNLPELEKLEINGNRLDEDSDALDLLQSKFDDLEVDDFEEVDSEDEEGEDEEDEDEDEKLEEIETERLEKELLEVQVDDLAERLAETEIK D77029B6783FFF09 D77029B6783FFF09 yrb1_yeast Ran-specific GTPase-activating protein 1 CST20 YRB1 Ran-binding protein 1 Perinuclear array-localized protein Chromosome stability protein 20 HTN1 SFO1 YDR002W YD8119.08 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSEDKKPVVDKKEEAAPKPPSSAVFSMFGGKKAEKPETKKDEEDTKEETKKEGDDAPESPDIHFEPVVHLEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKKA 46C3766B0906A75B 46C3766B0906A75B q1ae18_mumiv protein protein mvm Murine minute virus MVM Murine parvovirus MAGNAYSDEVLGTTNWLKEKSNQEVFSFVFKNEDVQLNGKDIGWNSYKKELQEEELKSLQRGAETTWDQSEDMEWESSVDELTKKFSTLTIHDTEKYASQPELCTNSTCIGSRGPGFRALEHTKYSCCGHCRNPEHWGSWFQSLPRWSTEPNLVRDRGGFESVLRCGTVEERLQRAAELGLRYDGASS mint 7A782A54CDE58F7A pkia-crm1 3 PKI alpha 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Wed Jul 06 16:48:17 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Ile532Ala [EBI-7979698]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 532-532, sequence length 76 [EBI-7979698]532-532 CRM1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified physical association physical association sf1b homomint mint Mutations of yeast CRM1 residues I532/L536/F572/F583 in the hydrophobic NES-binding cleft to alanines dramatically weakened the binding of PKI to CRM1 in the presence of RanGTP (Supplementary Figure S1) pkia-crm1-1 3 PKI alpha 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRM1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P30822:p.Val441_Leu442delinsAlaAla mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain VL AA Tue Jul 12 10:52:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:58:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val441ala' Tue Sep 04 16:40:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441Leu442delinsAlaAla' Tue Jun 30 16:10:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441_Leu442delinsAlaAla' physical association physical association f5b homomint mint the CRM1 mutation(s) in HEAT9 loop (V441D or V441A/L442A or V443D) substantially increased the binding of CRM1 to PKI in the absence of RanGTP (Figure 5B). pkia-crm1-2 3 CRM1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P30822:p.Val441Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:12:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:10:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val441asp' Tue Jun 30 17:20:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441Asp' PKI alpha 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5b homomint mint the CRM1 mutation(s) in HEAT9 loop (V441D or V441A/L442A or V443D) substantially increased the binding of CRM1 to PKI in the absence of RanGTP (Figure 5B). pkia-crm1-3 3 CRM1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P30822:p.Val443Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:12:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:16:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val443asp' Tue Jun 30 19:10:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val443Asp' PKI alpha 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5b homomint mint the CRM1 mutation(s) in HEAT9 loop (V441D or V441A/L442A or V443D) substantially increased the binding of CRM1 to PKI in the absence of RanGTP (Figure 5B). gsp1-crm1 3 NES of NS2 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRM1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain RanGTP 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f6b sf3a sf3b gsp1-crm1-1 3 CRM1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain RanBP1 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain RanGTP 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf3b homomint mint gsp1-rna1 3 RanGTP 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RanBP1 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain RanGAP 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified physical association physical association sf3b homomint mint crm1-pkia 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified P61925:p.Ile47Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:14:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:39:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile47ala' Tue Jun 30 19:31:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile47Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b homomint mint crm1-pkia-1 2 CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES physical association physical association homomint mint in presence of yeast RanGAP. f1d t1 f7a f7c crm1-pkia-2 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f1e t1 in presence of yeast RanGAP and yeast RanBP1 crm1-pkia-3 2 CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint in presence of yeast RanGAP. t1 sf3c crm1-pkia-4 2 CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified P30822:p.Val441Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:49:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:55:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val441asp' Tue Jun 30 17:13:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441Asp' cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint in presence of yeast RanGAP. t1 f5c crm1-pkia-5 2 CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P30822:p.Val441_Leu442delinsAlaAla mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain VL AA Tue Jul 12 10:49:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:57:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val441ala' Tue Sep 04 18:41:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441Leu442delinsAlaAla' Tue Jun 30 15:51:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441_Leu442delinsAlaAla' PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES physical association physical association homomint mint in presence of yeast RanGAP. t1 f5c crm1-pkia-6 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P30822:p.Val443Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:05:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:28:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val443asp' Tue Jun 30 19:57:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val443Asp' physical association physical association homomint mint in presence of yeast RanGAP. t1 f5c crm1-pkia-7 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified P30822:p.Pro754Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P D Tue Jul 12 10:49:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:45:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro754asp' Tue Jun 30 17:27:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro754Asp' cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint in presence of yeast RanGAP. t1 f6d f7b f7d pkia-xpo1 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRM1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association t1 homomint mint in presence of canine RanGAP. crm1-pkia-8 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified P30822:p.Val441Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:07:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:01:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val441asp' Tue Jun 30 19:07:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441Asp' cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint in presence of yeast RanGAP and RanBP1. t1 f5d crm1-pkia-9 2 CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES physical association physical association homomint mint in presence of yeast RanGAP and RanBP1 (aa 11-201). t1 sf3d crm1-pkia-10 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified P30822:p.Val441_Leu442delinsAlaAla mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain VL AA Tue Jul 12 10:20:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:32:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val441ala' Tue Sep 04 15:04:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441Leu442delinsAlaAla' Tue Jun 30 19:20:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val441_Leu442delinsAlaAla' cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint in presence of yeast RanGAP and RanBP1. t1 f5d crm1-pkia-11 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P30822:p.Pro754Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P D Tue Jul 12 10:21:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:57:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro754asp' Tue Jun 30 17:52:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro754Asp' physical association physical association homomint mint in presence of yeast RanGAP and RanBP1. t1 f6e crm1-pkia-12 2 PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified P30822:p.Val443Asp mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:58:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:14:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val443asp' Tue Jun 30 19:46:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val443Asp' cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint in presence of yeast RanGAP and RanBP1. t1 f5d pkia-xpo1-1 2 CRM1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor purified purified cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PKI alpha 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Leucine rich NES physical association physical association t1 homomint mint in presence of yeast RanGAP and Human RanBP1. crm1-gsp1 1 RanGTP 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified RanBP1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified CRM1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association homomint mint t2 f2 f3a f4 f6a sf9 Atomic coordinates and structure factors for the yeast CRM1:RanBP1:RanGTP complex have been deposited at the Protein Data Bank under accession code 3M1I.