MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Phosphatidylinositol-(4,5)-bisphosphate enables efficient secretion of HIV-1 Tat by infected T-cells. Phosphatidylinositol-(4,5)-bisphosphate enables efficient secretion of HIV-1 Tat by infected T-cells. EMBO J. (0261-4189) 2010 imex curation Rayne F., Debaisieux S., Yezid H., Lin YL., Mettling C., Konate K., Chazal N., Arold ST., Pugnière M., Sanchez F., Bonhoure A., Briant L., Loret E., Roy C., Beaumelle B. Only protein-protein interactions human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Rayne F., Debaisieux S., Yezid H., Lin YL., Mettling C., Konate K., Chazal N., Arold ST., Pugnière M., Sanchez F., Bonhoure A., Briant L., Loret E., Roy C., Beaumelle B. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation gag_hv1br Gag polyprotein gag Pr55Gag protein protein hv1br Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) HIV-1 MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSSQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHIARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPFLQSRPEPTAPPEESFRSGVETTTPSQKQEPIDKELYPLTSLRSLFGNDPSSQ mint 9103D701A843466F tat_hv1br Protein Tat tat Transactivating regulatory protein protein protein hv1br Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) HIV-1 MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE mint homomint 9B1B4A915FAF8A14 gag-tat 1 p24 2 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell p24 p24 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain TAT 3 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell colocalization colocalization homomint mint Neomycin displaces Tat and Gag from the plasma membrane of infected cells. f2d sf1 f5d