IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Thioredoxin targets of the plant chloroplast lumen and their implications for plastid function. Thioredoxin targets of the plant chloroplast lumen and their implications for plastid function. Proteomics (1615-9853) 2010 imex curation Hall M., Mata-Cabana A., Akerlund HE., Florencio FJ., Schroder WP., Lindahl M., Kieselbach T. Proteins were obtained from Thylakoid membranes as stated in Ref 2. (hence GO term entered) To isolate and identify Thioredoxin (Trx) targets, lumenal proteins were treated with N-ethylmaleimide to block exposed thiols and were then reduced by E. coli Trx/NTR reductase (NADPH-dependent thioredoxin reductase) in the presence of NADPH. Newly formed thiols were labelled with the fluorescent compound mBBr (monobromobimane) and lumenal proteins were separated by 2-DE IEF/SDS-PAGE. Fluorescent spots corresponding to mBBr-labelled proteins were visualised by excitation in UV light, excised and identified by PMF. Thomas.Kieselbach@chem.umu.se 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf enzymatic study enzymatic study fingerprinting peptide massfingerprinting fingerprinting Hall M., Mata-Cabana A., Akerlund HE., Florencio FJ., Schroder WP., Lindahl M., Kieselbach T. Proteins were obtained from Thylakoid membranes as stated in Ref 2. (hence GO term entered) To isolate and identify Thioredoxin (Trx) targets, lumenal proteins were treated with N-ethylmaleimide to block exposed thiols and were then reduced by E. coli Trx/NTR reductase (NADPH-dependent thioredoxin reductase) in the presence of NADPH. Newly formed thiols were labelled with the fluorescent compound mBBr (monobromobimane) and lumenal proteins were separated by 2-DE IEF/SDS-PAGE. Fluorescent spots corresponding to mBBr-labelled proteins were visualised by excitation in UV light, excised and identified by PMF. Thomas.Kieselbach@chem.umu.se Accepted 2010-SEP-5 by ORCHARD. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation Thioredoxin targets of the plant chloroplast lumen and their implications for plastid function. Thioredoxin targets of the plant chloroplast lumen and their implications for plastid function. Proteomics (1615-9853) 2010 imex curation Hall M., Mata-Cabana A., Akerlund HE., Florencio FJ., Schroder WP., Lindahl M., Kieselbach T. Proteins were obtained from Thylakoid membranes as stated in Ref 2. (hence GO term entered) To isolate and identify Thioredoxin (Trx) targets, lumenal proteins were treated with N-ethylmaleimide to block exposed thiols and were then reduced by E. coli Trx/NTR reductase (NADPH-dependent thioredoxin reductase) in the presence of NADPH. Newly formed thiols were labelled with the fluorescent compound mBBr (monobromobimane) and lumenal proteins were separated by 2-DE IEF/SDS-PAGE. Fluorescent spots corresponding to mBBr-labelled proteins were visualised by excitation in UV light, excised and identified by PMF. Thomas.Kieselbach@chem.umu.se 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf pull down pull down fingerprinting peptide massfingerprinting fingerprinting Hall M., Mata-Cabana A., Akerlund HE., Florencio FJ., Schroder WP., Lindahl M., Kieselbach T. Proteins were obtained from Thylakoid membranes as stated in Ref 2. (hence GO term entered) To isolate and identify Thioredoxin (Trx) targets, lumenal proteins were treated with N-ethylmaleimide to block exposed thiols and were then reduced by E. coli Trx/NTR reductase (NADPH-dependent thioredoxin reductase) in the presence of NADPH. Newly formed thiols were labelled with the fluorescent compound mBBr (monobromobimane) and lumenal proteins were separated by 2-DE IEF/SDS-PAGE. Fluorescent spots corresponding to mBBr-labelled proteins were visualised by excitation in UV light, excised and identified by PMF. The gene locus AT3G63535.1 given for TL19 does not correspond to any known gene locus. Thomas.Kieselbach@chem.umu.se Accepted 2010-SEP-5 by ORCHARD. 13-Sept-2010: Contacted by JYOTI. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation Thioredoxin targets of the plant chloroplast lumen and their implications for plastid function. Thioredoxin targets of the plant chloroplast lumen and their implications for plastid function. Proteomics (1615-9853) 2010 imex curation Hall M., Mata-Cabana A., Akerlund HE., Florencio FJ., Schroder WP., Lindahl M., Kieselbach T. Proteins were obtained from Thylakoid membranes as stated in Ref 2. (hence GO term entered) To isolate and identify Thioredoxin (Trx) targets, lumenal proteins were treated with N-ethylmaleimide to block exposed thiols and were then reduced by E. coli Trx/NTR reductase (NADPH-dependent thioredoxin reductase) in the presence of NADPH. Newly formed thiols were labelled with the fluorescent compound mBBr (monobromobimane) and lumenal proteins were separated by 2-DE IEF/SDS-PAGE. Fluorescent spots corresponding to mBBr-labelled proteins were visualised by excitation in UV light, excised and identified by PMF. Thomas.Kieselbach@chem.umu.se 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf enzymatic study enzymatic study fingerprinting peptide massfingerprinting fingerprinting Hall M., Mata-Cabana A., Akerlund HE., Florencio FJ., Schroder WP., Lindahl M., Kieselbach T. Proteins were obtained from Thylakoid membranes as stated in Ref 2. (hence GO term entered) To isolate and identify Thioredoxin (Trx) targets, lumenal proteins were treated with N-ethylmaleimide to block exposed thiols and were then reduced by E. coli Trx/NTR reductase (NADPH-dependent thioredoxin reductase) in the presence of NADPH. Newly formed thiols were labelled with the fluorescent compound mBBr (monobromobimane) and lumenal proteins were separated by 2-DE IEF/SDS-PAGE. Fluorescent spots corresponding to mBBr-labelled proteins were visualised by excitation in UV light, excised and identified by PMF. Thomas.Kieselbach@chem.umu.se Accepted 2010-SEP-5 by ORCHARD. 13-Sept-2010: Contacted by JYOTI. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation f4j036_arath PIFI At3g15840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAAANTSAVFASPSQPLSSKRSFLYSSRIGPILRRFPRKKLDLQVKAVATTLAPLEEIKEYKLPSWAMFEMGTAPVYWKTMNGLPPTSGEKLKLFYNPAASKLTLNEDYGVAFNGGFNQPIMCGGEPRAMLKKDRGKADSPIYTMQICIPKHAVNLIFSFTNGVDWDGPYRLQFQVPKRWQNKPIEFFNEGLANELSQDGACERAIFPDSNVVPTRCTMIANLTVEGVNRCNLDLVPGCMDTNSEHFNPYANVDDGSCPLELSDSDE 1B998297F2F9A8B6 vde_arath Violaxanthin de-epoxidase, chloroplastic VDE1 AVDE1 NPQ1 VXDE Protein NON-PHOTOCHEMICAL QUENCHING 1 F22O13.3 T27G7.23 At1g08550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVATHCFTSPCHDRIRFFSSDDGIGRLGITRKRINGTFLLKILPPIQSADLRTTGGRSSRPLSAFRSGFSKGIFDIVPLPSKNELKELTAPLLLKLVGVLACAFLIVPSADAVDALKTCACLLKGCRIELAKCIANPACAANVACLQTCNNRPDETECQIKCGDLFENSVVDEFNECAVSRKKCVPRKSDLGEFPAPDPSVLVQNFNISDFNGKWYITSGLNPTFDAFDCQLHEFHTEGDNKLVGNISWRIKTLDSGFFTRSAVQKFVQDPNQPGVLYNHDNEYLHYQDDWYILSSKIENKPEDYIFVYYRGRNDAWDGYGGAVVYTRSSVLPNSIIPELEKAAKSIGRDFSTFIRTDNTCGPEPALVERIEKTVEEGERIIVKEVEEIEEEVEKEVEKVGRTEMTLFQRLAEGFNELKQDEENFVRELSKEEMEFLDEIKMEASEVEKLFGKALPIRKVR 58E37B2C12D4426B thio_ecoli Thioredoxin 1 trxA fipA tsnC b3781 JW5856 protein protein ecoli Escherichia coli (strain K12) MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA DIP protein P0AA25 original sequence version: 67 EF5933EA29668EE9 ctpa2_arath Carboxyl-terminal-processing peptidase 2, chloroplastic CTPA2 D1 C-terminal processing protease 2 Photosystem II D1 protein processing peptidase 2 FCAALL.169 dl4905c At4g17740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVLASSSLSPISFTKPNKINPNFSIQVKLWVKQPPKISKASKFSYARSRSNISRSNAANPGVVFVCNRFLCVIERNDQRKLSGKVMMKSSVNFRQNLSVALVRIVSVLLVSSISVVTTDSPPSWGLTEENLLFLEAWRTIDRAYIDKTFNGQSWFRYRETALRNEPMNTREETYMAIKKMVATLDDPFTRFLEPGKFKSLRSGTQGAVTGVGLSIGYPTASDGPPAGLVVISAAPGGPANRAGILPGDVIQGIDNTTTETLTIYDAAQMLQGPEGSAVELAIRSGPETRLLTLTRERVSVNPVKSRLCELPGSGSNSPKIGYIKLTTFNQNASSAVREAIETLRGNNVNAFVLDLRDNSGGSFPEGIEIAKFWLDKGVIVYICDSRGVRDIYDTDGSNAIATSEPLAVLVNKGTASASEILAGALKDNKRALVYGEPTYGKGKIQSVFELSDGSGLAVTVARYETPAHTDIDKVGVTPDHPLPKSFPKDEEAFCGCLKDPTAACYLNQGLLFSR 704BE277C41F0F52 psbp1_arath Oxygen-evolving enhancer protein 2-1, chloroplastic PSBP1 PSBP 23 kDa subunit of oxygen evolving system of photosystem II OEC 23 kDa subunit 23 kDa thylakoid membrane protein F12K11.3 F4H5_18 At1g06680 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQSHEDDNSAVSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA F79549FCE8F6F384 cyp38_arath Peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic CYP38 Rotamase CYP38 Thylakoid lumen PPIase F4P13.3 At3g01480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAAFASLPTFSVVNSSRFPRRRIGFSCSKKPLEVRCSSGNTRYTKQRGAFTSLKECAISLALSVGLMVSVPSIALPPNAHAVANPVIPDVSVLISGPPIKDPEALLRYALPIDNKAIREVQKPLEDITDSLKIAGVKALDSVERNVRQASRTLQQGKSIIVAGFAESKKDHGNEMIEKLEAGMQDMLKIVEDRKRDAVAPKQKEILKYVGGIEEDMVDGFPYEVPEEYRNMPLLKGRASVDMKVKIKDNPNIEDCVFRIVLDGYNAPVTAGNFVDLVERHFYDGMEIQRSDGFVVQTGDPEGPAEGFIDPSTEKTRTVPLEIMVTGEKTPFYGSTLEELGLYKAQVVIPFNAFGTMAMAREEFENDSGSSQVFWLLKESELTPSNSNILDGRYAVFGYVTDNEDFLADLKVGDVIESIQVVSGLENLANPSYKIAG 7239C7ADE83953E0 ctpa1_arath Carboxyl-terminal-processing peptidase 1, chloroplastic CTPA1 D1 C-terminal processing protease 1 Photosystem II D1 protein processing peptidase 1 MPL12.19 At5g46390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRLLLPFSSPLSATSSPSTPQFIPELPPPSQFDYSGLTKILKKSVIGTLTGALSLTLVFSSPISSVAATNDPYLSVNPPSSSFESSLNHFDSAPEDCPNEEEADTEIQDDDIEPQLVTNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDILASPIKSRSKAHEVIKNMLASLGDQYTRFLSPDEFSRMSKYDITGIGINLREVSDGGGNVKLKVLGLVLDSAADIAGVKQGDEILAVNGMDVSGKSSFEVSSLLQGPSKTFVVLKVKHGKCGPVKSLKIQRQVNAQTPVSYRLEKVDNGTVSVGYIRLKEFNALARKDLVIAMKRLLDKGASYFVMDLRDNLGGLVQAGIETAKLFLDEGDTVIYTAGRDPEAQKTVVSDKKPLITAPLIVMVNNRTASASEIVASALHDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPAWDEVKERLSKCSILQQS E421EF7DE41FBAB8 prxq_arath Peroxiredoxin Q, chloroplastic Thioredoxin-dependent peroxiredoxin Q MPE11_21 At3g26060 PRXQ Thioredoxin peroxidase protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASSSSFTLCNHTTLRTLPLRKTLVTKTQFSVPTKSSESNFFGSTLTHSSYISPVSSSSLKGLIFAKVNKGQAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLKAA 5DACF66AC059D10E fnrl2_arath Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic LFNR2 PETH2 Leaf FNR 2 T20H2.20 At1g20020 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATTMNAAVSLTSSNSSSFPATSCAIAPERIRFTKGAFYYKSNNVVTGKRVFSIKAQITTETDTPTPAKKVEKVSKKNEEGVIVNRYRPKEPYTGKCLLNTKITADDAPGETWHMVFSHQGEIPYREGQSVGVIADGIDKNGKPHKVRLYSIASSALGDLGNSETVSLCVKRLVYTNDQGETVKGVCSNFLCDLAPGSDVKLTGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTTSSLLYQEEFDKMKAKAPENFRVDYAISREQANDKGEKMYIQTRMAQYAAELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAANDGIDWFDYKKQLKKAEQWNVEVY DA49E26B60F9CF73 thio_syny3 Thioredoxin trxA slr0623 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSATPQVSDASFKEDVLDSELPVLVDFWAPWCGPCRMVAPVVDEISQQYEGKVKVVKLNTDENPNTASQYGIRSIPTLMIFKGGQRVDMVVGAVPKTTLASTLEKYL C03FAA09EACEC333 tl19_arath Thylakoid lumenal 19 kDa protein, chloroplastic P19 TEL3S At3g63540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATKIFLASPVISATRTPIVPKAIASRLGTSLAAALAATSVLTMVPVLPAAGEGNQTYKIYYGTAASAANYGGYGGNSDRKTSAEYVYDVPEGWKERLVSKVEKGTNGTDSEFYNPKKKTEKEYLTFLAGFRQLAPRDVILNNLALSDVELQDLIAGADKVVSEERKDETGQVYYLYEIDGVGKHSLITVTCSKNRLYAHFVNAPAPEWNRDHDTLTHLRDSFKTVSSS 51777DD744FE09D5 q56zz9_arath At5g66190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVSLAAKDGIDWLEYKKQLKRSEQWNVEVY E295B0628E7E2634 ppd6_arath PsbP domain-containing protein 6, chloroplastic PPD6 OEC23-like protein 1 T5P19.300 At3g56650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATASLVPTSKIFSVSPKSSASIKARSRVVVASSQQQQQPRRRELLLKSAVAIPAILQLKEAPISAAREVEVGSYLPLSPSDPSFVLFKAKPSDTPALRAGNVQPYQFVLPPNWKQLRIANILSGNYCQPKCAEPWIEVKFENEKQGKVQVVASPLIRLTNKPNATIEDLGEPEKVIASLGPFVTGNSYDSDELLKTSIEKIGDQTYYKYVLETPFALTGSHNLAKATAKGSTVVLFVVSATEKQWQSSQKTLEAILDSFQL 9D402FA4A9DC083E degp1_arath Protease Do-like 1, chloroplastic DEGP1 DEGP DEG1 Protein DEGRADATION OF PERIPLASMIC PROTEINS 1 K16N12.18 At3g27925 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATTTSCSLLLSSTLFLHSPPSSHLSFFNLSSSRSSPISLYPIRSKRYFRILSKLSLNDNNRDDDDDTLHFTPFSAVKPFFLLCTSVALSFSLFAASPAVESASAFVVSTPKKLQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGASSGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGVSGVLVLDAPPSGPAGKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRGDHKEKISVTLEPKPDES DIP protein O22609 original sequence version: 103 05EB437DCE71A251 fk202_arath Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic FKBP20-2 FK506-binding protein 20-2 Immunophilin FKBP20-2 Rotamase T8B10.30 At3g60370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVTILSTPLSPRLTFLCETKLSLSRSNRSVCCSLSEEPKDQCLSRRSLVYVLVASPCLLLPALSSSAKTKSKSPYDERRLLEQNKRIQRENNAPDEFPNFVREGFEVKVLASDNYIKADSGLIYRDFNVGQGDFPKDGQQVTFHYIGYNESGRRIDSTYIQGSPARIRMGTNALVPGFEMGIRDMKPGGRRRIIIPPELGPPVGPSTFFSSKQFEVFDVELLSIQNCERRTIIGFYSDVTCS A288DC4D46C481D9 tl17_arath Thylakoid lumenal 17.4 kDa protein, chloroplastic TL17 P17.4 MNC6.3 At5g53490 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASLPVQFTRNQISSPFFSVNLRREPRSLVTVHCSAGENRENGEGVKKSLFPLKELGSIACAALCACTLTIASPVIAANQRLPPLSTEPDRCEKAFVGNTIGQANGVYDKPLDLRFCDYTNDQTNLKGKTLSAALMVGAKFDGADMTEVVMSKAYAVEASFKGVNFTNAVIDRVNFGKSNLKGAVFRNTVLSGSTFEEANLEDVVFEDTIIGYIDLQKICRNESINEEGRLVLGCR D14502C4372A3A14 pap6_arath Plastid-lipid-associated protein 6, chloroplastic PAP6 HRBP1 Fibrillin-6 Harpin-binding protein 1 FBN4 FIB4 Fibrillin-4 PGL30.4 Plastoglobulin 30.4 MLM24.13 At3g23400 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATSSTFSSLLPSPPALLSDHRSPPPSIRYSFSPLTTPKSSRLGFTVPEKRNLAANSSLVEVSIGGESDPPPSSSGSGGDDKQIALLKLKLLSVVSGLNRGLVASVDDLERAEVAAKELETAGGPVDLTDDLDKLQGKWRLLYSSAFSSRSLGGSRPGLPTGRLIPVTLGQVFQRIDVFSKDFDNIAEVELGAPWPFPPLEATATLAHKFELLGTCKIKITFEKTTVKTSGNLSQIPPFDIPRLPDSFRPSSNPGTGDFEVTYVDDTMRITRGDRGELRVFVIA 142104702C1DC284 degp5_arath Protease Do-like 5, chloroplastic DEGP5 HHOA F28J12.30 At4g18370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTMALASSKAFSSIFNTLSPINQSKFVLACSGSNHVDVIDRRRRIMIFGSSLALTSSLLGSNQQRLPMESAIALEQFKEKEEELEEEEERNVNLFQKTSPSVVYIEAIELPKTSSGDILTDEENGKIEGTGSGFVWDKLGHIVTNYHVIAKLATDQFGLQRCKVSLVDAKGTRFSKEGKIVGLDPDNDLAVLKIETEGRELNPVVLGTSNDLRVGQSCFAIGNPYGYENTLTIGVVSGLGREIPSPNGKSISEAIQTDADINSGNSGGPLLDSYGHTIGVNTATFTRKGSGMSSGVNFAIPIDTVVRTVPYLIVYGTAYRDRF D1F929C721E53422 rbl_arath Ribulose bisphosphate carboxylase large chain rbcL AtCg00490 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVEGNEIIREACKWSPELAAACEVWKEITFNFPTIDKLDGQE 3086705F3C8FEF75 fkb13_arath Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic FKBP13 FKBPK Rotamase FK506-binding protein 1 MRA19.7 At5g45680 FK506-binding protein 13 FKBP22-1 Immunophilin FKBP13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLGFSVGTCSPPSEKRKCRFLVNNSLNKAEAINLRNKQKVSSDPELSFAQLSSCGRREAIIGFGFSIGLLDNVSALAETTSCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA 4E6640FE7955A48F psan_arath Photosystem I reaction center subunit N, chloroplastic PSAN MHJ24.2 At5g64040 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAMNSSVLTCSYAIAGSGSVELNQKVGLVNSSVGFGQKKQMIMPVIKAQRVVGDDVDGSNGRRSAMVFLAATLFSTAAVSASANAGVIDEYLERSKTNKELNDKKRLATSGANFARAFTVQFGSCKFPENFTGCQDLAKQKKVPFISEDIALECEGKDKYKCGSNVFWKW 82FE2AFF7C599C07 tl203_arath Thylakoid lumenal protein TL20.3, chloroplastic TL20.3 T28K15.2 At1g12250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAFSSLSPLPMKSLDISRSSSSVSRSPYHFQRYLLRRLQLSSRSNLEIKDSSNTREGCCSSAESNTWKRILSAAMAAAVIASSSGVPAMAELNRFEADTRGEFGIGSAAQYGSADLSKTVHSNENFRRANFTSADMRESDFSGSTFNGAYLEKAVAYKANFSGADLSDTLMDRMVLNEANLTNAVLVRSVLTRSDLGGAKIEGADFSDAVIDLLQKQALCKYATGTNPLTGVDTRKSLGCGNSRRNAYGSPSSPLLSAPPQRLLGRDGFCDEKTGLCDVK 81CA7C8428ADBF1D tl15a_arath Thylakoid lumenal 15 kDa protein 1, chloroplastic p15 T13E15.7 At2g44920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVILSNVSLFSCCNISQKPSLFSPSSRSSHCPIRCSQSQEGKEVVTSPLRSVVWSLGEEVSKRSLFALVSASLFFVDPALAFKGGGPYGQGVTRGQDLSGKDFSGQTLIRQDFKTSILRQANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATVTGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNATRDTLLCN ABCECC58F04ADEE4 psbo2_arath Oxygen-evolving enhancer protein 1-2, chloroplastic OEC 33 kDa subunit 33 kDa thylakoid membrane protein Manganese-stabilizing protein 2 33 kDa subunit of oxygen evolving system of photosystem II PSBO2 At3g50820 F18B3.100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE 08F837E651B1C2E7 psbo1_arath Oxygen-evolving enhancer protein 1-1, chloroplastic 33 kDa subunit of oxygen evolving system of photosystem II OEC 33 kDa subunit 33 kDa thylakoid membrane protein Manganese-stabilizing protein 1 PSBO1 PSBO At5g66570 K1F13.25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE 73174DDC09C11E5C tl29_arath Thylakoid lumenal 29 kDa protein, chloroplastic TL29 APX4 P29 AtAPx07 F23J3.40 At4g09010 Probable L-ascorbate peroxidase 4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGVSFLSTVPSFTNTTNHQHLTTLSSSSHRSAVIRCSKIEPQVSGESLAFHRRDVLKLAGTAVGMELIGNGFINNVGDAKAADLNQRRQRSEFQSKIKILLSTTIKAKPELVPSLLKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEEVKKEIDSISKGGPISYADIIQLAGQSAVKFTYLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADPEGRVPQWGKATVQEMKDKFIAVGLGPRQLAVMSAFLGPDQAATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPVERINLSKLKL ABD439188BDA8E61 trx-psbo2-1 1 27 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. rtrx-apx4 2 22 enzyme target enzyme target substrate substrate prey prey 12 enzyme target enzyme target substrate substrate prey prey 15 enzyme target enzyme target substrate substrate prey prey 4 enzyme target enzyme target substrate substrate prey prey 20 enzyme target enzyme target substrate substrate prey prey 17 enzyme target enzyme target substrate substrate prey prey 25 enzyme target enzyme target substrate substrate prey prey 10 enzyme target enzyme target substrate substrate prey prey 24 enzyme target enzyme target substrate substrate prey prey 21 enzyme target enzyme target substrate substrate prey prey 7 enzyme target enzyme target substrate substrate prey prey 27 enzyme target enzyme target substrate substrate prey prey 9 enzyme target enzyme target substrate substrate prey prey 8 enzyme target enzyme target substrate substrate prey prey 5 enzyme target enzyme target substrate substrate prey prey 28 enzyme target enzyme target substrate substrate prey prey 11 enzyme target enzyme target substrate substrate prey prey 13 enzyme enzyme bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 enzyme target enzyme target substrate substrate prey prey 29 enzyme target enzyme target substrate substrate prey prey 14 unspecified role unspecified role prey prey association association Isolation of proteins in the Arabidopsis thylakoid lumen that interacted with Trx using Trx affinity chromatography. Table 1, Fig 3. [EBI-2895896] The protein has been merged with EBI-2895880 so the duplicated interactor has been deleted from this interaction. [EBI-2895923] The protein has been merged with EBI-2895910 so the duplicated interactor has been deleted from this interaction. trx-vde-2 1 5 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-ppd6-1 1 6 electron donor electron donor neutral component neutral component 16 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-apx4-1 1 6 electron donor electron donor neutral component neutral component 29 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-psbo1-1 1 6 electron donor electron donor neutral component neutral component 28 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-prxg-1 1 6 electron donor electron donor neutral component neutral component 11 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-tl17-1 1 6 electron donor electron donor neutral component neutral component 19 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-fkbp3-1 1 6 electron donor electron donor neutral component neutral component 23 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-tl15a 1 6 electron donor electron donor neutral component neutral component 26 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-psbp1 1 6 electron donor electron donor neutral component neutral component 8 electron acceptor electron acceptor neutral component neutral component enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-psbo2 3 27 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-vde-1 3 5 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-ppd6 3 16 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-apx4 3 29 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-psbo1 3 28 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-prxg 3 11 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-tl17 3 6 electron donor electron donor neutral component neutral component 19 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-fkbp3 3 6 electron donor electron donor neutral component neutral component 23 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-tl15 3 6 electron donor electron donor neutral component neutral component 26 electron acceptor electron acceptor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B. trx-fkbp6 3 18 electron acceptor electron acceptor neutral component neutral component 6 electron donor electron donor neutral component neutral component redox reaction oxidoreductase activity electron transfer reaction redox reaction Trx targets detected in the lumenal chloroplast fraction of Arabidopsis thaliana. Table 1, Fig 1B.