MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Inhibition of the shade avoidance response by formation of non-DNA binding bHLH heterodimers. Inhibition of the shade avoidance response by formation of non-DNA binding bHLH heterodimers. EMBO J. (0261-4189) 2009 imex curation Hornitschek P., Lorrain S., Zoete V., Michielin O., Fankhauser C. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hornitschek P., Lorrain S., Zoete V., Michielin O., Fankhauser C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Inhibition of the shade avoidance response by formation of non-DNA binding bHLH heterodimers. Inhibition of the shade avoidance response by formation of non-DNA binding bHLH heterodimers. EMBO J. (0261-4189) 2009 imex curation Hornitschek P., Lorrain S., Zoete V., Michielin O., Fankhauser C. Only protein-protein interactions in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hornitschek P., Lorrain S., Zoete V., Michielin O., Fankhauser C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation Inhibition of the shade avoidance response by formation of non-DNA binding bHLH heterodimers. Inhibition of the shade avoidance response by formation of non-DNA binding bHLH heterodimers. EMBO J. (0261-4189) 2009 imex curation Hornitschek P., Lorrain S., Zoete V., Michielin O., Fankhauser C. Only protein-protein interactions onion-epidermis Allium cepa epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc immunostaining immunostaining Hornitschek P., Lorrain S., Zoete V., Michielin O., Fankhauser C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation pif4_arath Transcription factor PIF4 Transcription factor EN 102 bHLH transcription factor bHLH009 Basic helix-loop-helix protein 9 Short under red-light 2 PIF4 BHLH9 SRL2 At2g43010 MFL8.13 EN102 Phytochrome-interacting factor 4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTDKASILDEAIDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPMEMLRFSSPAGQQSQQPSSVPTKTTDGSRLDH DIP protein Q8W2F3 original sequence version: 103 DIP protein Q8W2F3-1 original sequence version: 120 B4C081D0BF907C26 pif5_arath Transcription factor PIF5 PIL6 Basic helix-loop-helix protein 65 Phytochrome interacting factor-like 6 F17J16.110 PIF5 EN103 Phytochrome-interacting factor 5 At3g59060 Transcription factor EN 103 BHLH65 bHLH transcription factor bHLH065 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQVFADWNFEDNFHMSTNKRSIRPEDELVELLWRDGQVVLQSQARREPSVQVQTHKQETLRKPNNIFLDNQETVQKPNYAALDDQETVSWIQYPPDDVIDPFESEFSSHFFSSIDHLGGPEKPRTIEETVKHEAQAMAPPKFRSSVITVGPSHCGSNQSTNIHQATTLPVSMSDRSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSVTIDRKRKHVMDADQESVSQSDIGLTSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTDKASILDEAIDYLKSLQMQLQVMWMGSGMAAAAAAAASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNRSAPQNHPGLVCQNPVQLQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADMLGFGSPAGPQSQLSAPATTDSLHMGKIG 593D72C1F2ED86C7 hfr1_arath Transcription factor HFR1 Transcription factor EN 68 bHLH transcription factor bHLH026 HFR1 BHLH26 EN68 Basic helix-loop-helix protein 26 Reduced sensitivity to far-red light Protein LONG HYPOCOTYL IN FAR-RED 1 FBI1 Protein REDUCED PHYTOCHROME SIGNALING REP1 RSF1 At1g02340 T6A9.4 T6A9_13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNNQAFMELGWRNDVGSLAVKDQGMMSERARSDEDRLINGLKWGYGYFDHDQTDNYLQIVPEIHKEVENAKEDLLVVVPDEHSETDDHHHIKDFSERSDHRFYLRNKHENPKKRRIQVLSSDDESEEFTREVPSVTRKGSKRRRRDEKMSNKMRKLQQLVPNCHKTDKVSVLDKTIEYMKNLQLQLQMMSTVGVNPYFLPATLGFGMHNHMLTAMASAHGLNPANHMMPSPLIPALNWPLPPFTNISFPHSSSQSLFLTTSSPASSPQSLHGLVPYFPSFLDFSSHAMRRL BC75C5EB26E10A20 pif5-hfr1 2 PIF5 5 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HFR1 6 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q9FE22:p.Leu173Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L E Tue Jul 12 10:57:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:01:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu173glu' Tue Jun 30 19:31:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu173Glu' Q9FE22:p.Val172Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:21:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:57:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val172asp' Tue Jun 30 18:04:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val172Asp' direct interaction direct interaction f3b mint pif4-hfr1 2 PIF4 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HFR1 6 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q9FE22:p.Leu173Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L E Tue Jul 12 10:21:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:35:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu173glu' Tue Jun 30 17:34:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu173Glu' Q9FE22:p.Val172Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:21:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:58:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val172asp' Tue Jun 30 16:24:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val172Asp' direct interaction direct interaction f3a mint hfr1-pif4 3 PIF4 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HFR1 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q9FE22:p.Val172Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:24:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:45:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val172asp' Tue Jun 30 16:35:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val172Asp' Q9FE22:p.Leu173Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L E Tue Jul 12 10:59:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:47:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu173glu' Tue Jun 30 18:34:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu173Glu' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3c mint hfr1-pif5 3 PIF5 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HFR1 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9FE22:p.Val172Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:23:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:18:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val172asp' Tue Jun 30 18:10:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val172Asp' Q9FE22:p.Leu173Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L E Tue Jul 12 10:23:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:44:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu173glu' Tue Jun 30 20:06:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu173Glu' physical association physical association f3c mint hfr1-pif5-1 1 HFR1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PIF5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3d mint