IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A dimeric structure for archaeal box C/D small ribonucleoproteins. A dimeric structure for archaeal box C/D small ribonucleoproteins. Science (0036-8075) 2009 imex curation Bleichert F., Gagnon KT., Brown BA., Maxwell ES., Leschziner AE., Unger VM., Baserga SJ. Archaea - Interaction dataset based on Archaea proteins 10-25% glycerol gradient susan.baserga@yale.edu 21-Dec-2010: Contacted by JYOTI. 2010-11-04: migleg@ibt.lt jyoti Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Bleichert F., Gagnon KT., Brown BA., Maxwell ES., Leschziner AE., Unger VM., Baserga SJ. Archaea - Interaction dataset based on Archaea proteins 10-25% glycerol gradient susan.baserga@yale.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. 2010-11-04: migleg@ibt.lt Science (0036-8075) 2009 jyoti Only protein-protein interactions imex curation A dimeric structure for archaeal box C/D small ribonucleoproteins. A dimeric structure for archaeal box C/D small ribonucleoproteins. Science (0036-8075) 2009 imex curation Bleichert F., Gagnon KT., Brown BA., Maxwell ES., Leschziner AE., Unger VM., Baserga SJ. Archaea - Interaction dataset based on Archaea proteins 10-25% glycerol gradient susan.baserga@yale.edu 21-Dec-2010: Contacted by JYOTI. 2010-11-04: migleg@ibt.lt jyoti Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Bleichert F., Gagnon KT., Brown BA., Maxwell ES., Leschziner AE., Unger VM., Baserga SJ. Archaea - Interaction dataset based on Archaea proteins 10-25% glycerol gradient susan.baserga@yale.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. 2010-11-04: migleg@ibt.lt Science (0036-8075) 2009 jyoti Only protein-protein interactions imex curation flpa_metja Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase flpA MJ0697 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK 9ECAAD7C4C606756 rl7a_metja 50S ribosomal protein L7Ae rpl7ae Ribosomal protein L8e MJ1203 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ 7CAB706F09371BA6 sr8_metja_rna Methanocaldococcus jannaschii sR8 small RNA rna ribonucleic acid RNA rna methanocaldococcus jannaschii Methanocaldococcus jannaschii Methanococcus jannaschii y694_metja Uncharacterized NOP5 family protein MJ0694 MJ0694 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MIYVTFTPYGAFGVKDNKEVSGLEDIEYKKLFNEEEIPDIMFKLKTQPNKIADELKEEWGDEIKLETLSTEPFNIGEFLRNNLFKVGKELGYFNNYDEFRKKMHYWSTELTKKVIKSYAQQKDKIIIQVAEAISDLDKTLNLLSERLREWYSLYFPELDHLVNKHEVYANLITKLGKRKNFTKSQLKKILPSKLAGKIAEAAKNSMGGELEDYDLDVIVKFAEEINHLYEKRKELYNYLEKLMNEEAPNITKLAGVSLGARLIGLAGGLEKLAKMPASTIQVLGAEKALFAHLRMGVEPPKHGIIYNHPLIQGSPHWQRGKIARALACKLAIAARADYVGDYIADELLEKLNKRVEEIRRKYPKPPKKKKKEKPKAKKKEKKGKKEKSKKKKDKKKDKKGKKERKVIGKTKSRK A9092EFC3C82C407 flpa-rpl7ae-3 1 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component physical association physical association Figs. 1B, 1C Assembly required the presence of the sR8 small RNA flpa-rpl7ae-4 2 3 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2A The EM structure was refined to a resolution of 27A rpl7ae-nop5-1 2 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component coiled coil region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 3A, 4A-C The Nop5 mutant lacking the coiled coil region still assembles into complexes containing all box C/D sRNP components, including the sRNA and L7, but they are not di-sRNPs i.e. are not catalytically active suggesting correct binding and assembly is impaired. rpl7ae-nop5-2 1 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B rpl7ae-nop5-3 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3A rpl7ae-nop5-4 2 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B