MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it REDD2 is enriched in skeletal muscle and inhibits mTOR signaling in response to leucine and stretch. REDD2 is enriched in skeletal muscle and inhibits mTOR signaling in response to leucine and stretch. Am. J. Physiol., Cell Physiol. (0363-6143) 2009 Miyazaki M., Esser KA. partial coverage rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Miyazaki M., Esser KA. Am. J. Physiol., Cell Physiol. (0363-6143) 2009 partial coverage rapid curation ddt4l_mouse DNA damage-inducible transcript 4-like protein Ddit4l Rtp801l Smhs1 HIF-1 responsive protein RTP801-like Soleus muscle atrophied after hindlimb suspension protein 1 protein protein mouse Mus musculus Mouse MVATGSLSSKNPASISELLDGGYHPGSLLSDFDYWDYVVPEPNLNEVVFEETTCQNLVKMLENCLSRSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDASVVPTFELTLVFKQESCPWTSLKDFFFSRGRFSSGLKRTLILSSGFRLVKKKLYSLIGTTVIEEC mint Inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1 53648D6100CE5B0D 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 ddit4l-ywhab 1 DDT4L_MOUSE 2 unspecified role unspecified role unspecified role unspecified role 1433B_HUMAN 3 unspecified role unspecified role unspecified role unspecified role association association domino mint