IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Eukaryotic Cell (1535-9778) 2008 imex curation Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu mgt Only protein-protein interactions dicdi Dictyostelium discoideum (Slime mold) Slime mold pull down pull down western blot western blot Immuno blot Immuno blot Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu Accepted 2010-DEC-14 by MGT Eukaryotic Cell (1535-9778) 2008 mgt Only protein-protein interactions imex curation Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Eukaryotic Cell (1535-9778) 2008 imex curation Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu mgt Only protein-protein interactions dicdi Dictyostelium discoideum (Slime mold) Slime mold pull down pull down anti tag western anti tag western blot anti tag western Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu Accepted 2010-DEC-14 by MGT Eukaryotic Cell (1535-9778) 2008 mgt Only protein-protein interactions imex curation Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Eukaryotic Cell (1535-9778) 2008 imex curation Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu mgt Only protein-protein interactions dicdi Dictyostelium discoideum (Slime mold) Slime mold anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu Accepted 2010-DEC-14 by MGT Eukaryotic Cell (1535-9778) 2008 mgt Only protein-protein interactions imex curation Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Dictyostelium Aurora kinase has properties of both Aurora A and Aurora B kinases. Eukaryotic Cell (1535-9778) 2008 imex curation Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu mgt Only protein-protein interactions dicdi Dictyostelium discoideum (Slime mold) Slime mold fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Li H., Chen Q., Kaller M., Nellen W., Graf R., De Lozanne A. a.delozanne@mail.utexas.edu Accepted 2010-DEC-14 by MGT Eukaryotic Cell (1535-9778) 2008 mgt Only protein-protein interactions imex curation q54rn0_dicdi DDB0220646 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MGKRDKRIIEEPEEPEEAGDVFEVEKILDKRVQHGRIQYSIRWKGFTADYDTWEDEDNVAGCPELVKEFESSREQEKKKSRKRKNVIVNDDQTAVESSSPPPTTKPSSSSSSTKTTKAATSTTTNTSTQQKTNHLIDDEEYIKNEYIKFGVPYIEGIGFENGHCVEEIIGCKPFGQDNTLFFFVKWRGQEKLSWVLNEILKHKEPLQLIEFYENRLKFGYKGQQS 858C9136E47A5FFE aurk_dicdi Aurora kinase aurK AurB Aurora DDB_G0279343 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSYPNNKENSNNIGGGSFSVPSKQPQRVLQQQNTNINNHQTTSTVKSTITKPTTTGATTSTNTSTIPPTTTASSSSSSSSSSSSSSSSSSSSSSSSSQSVPKKKWCIDDFDIGKLLGMGRFGHVYLAREKKSQFIVALKVLFKNQLQTHNIEHQLRREIEIQSHLRHPNILRLFGYFYDDKRVFLIIEFAKGGECFKELQKVGSFNEQTAATYTLQIADALRYCHSKHVIHRDIKPENLLIGVGGEIKIADFGWSVHAPNTKRSTFCGTLEYLPPEVIEKKGYDQTADVWSLGILIFEFLVGRSPFTSDEEKNIFHNIQENDVYYPSSISPEAKDLISRLLVSDPHQRITLKDVINHPWIKKHAHPKSLEPTKLGLPLPSQMTY F8085ED1A6539D94 icpa_dicdi Inner centromere protein A icpA Incenp DdINCENP DDB_G0267690 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MDSIKKNTINRINGLPINHNNLSKTSIISMDDDYNSNSSFYSTNNSILNSVTKNSNYLNNNNNNNNNNNNNNNISISNCNNNNTNNKINEQLKTFNNIFEEKGEFLKEEIDNKFNDIISLMNQSKNQLFLSLNDIDSLYDLSPLSTTSTITLENNNNNNNNLIKFKLFNNDSIKKYILPVSSKTIKFKQRQILIEQQEFNEKHNQQKHLLELQRQQVLSDQQNQFQEQHKQQLSLKQQELEAIQQDTNKVKQQLIETHDKLLIEKEKQFKQDLNSLELNLQNKFTNEYQSKEQEFNKKLEQQQQQLEKQFQQTKELLIVQETLTLKSKLTTEFQEQLKTHQDQINKQELLLKQQEYQLFLKQQEISSIQKQHQDDLSSLKSKLSSDQDQIKKQLLQQESDLLKKQQELLLKQQELDIQSKQLKEEQEKQQQQQEKQQEKQQQQQPVVVPVKPTTSTVVSATTATLIKAPIVSTTTVSTATVSKLVTNGIAKPTPLTTMKQTVTAVPTLMDNKTRLKKLVPTATTTTTKEENNKEYDKMMQELDTQPNNSNLKNLNEKKLETLKQQLTFDDSVSFSNGNDESSINLSKYLEETNKSVENTFDIMSNTLKRKNEPIQQPSSSSSQLSSSQQPSSSSSSSSSSIGLKKRLSDDKTTIVTSKPTNKVQPQSLNSNINNNVVPPSPVAAIANKLKKQQELEKLKLEEEERLRKKQEEQLAKREVEKEQERLEKKKKNDEKRKKVEENQQQRILEEEKKKKEAEDRELARKHKEDSDKKKREEEEDAKKRIQERFRETQEQERKREEFKKQQQEQELARIKKEKLQQEKLQQEKEKQEKQKQQQQQQEEEQQKKKTVQTILPTPQTPSRSANNNYDDAANTASATKAKYALSSILSMVFGATKSPHFKPSTSQDDQDDDDCEDYDGTDENSENEAKGEYQDDSDQEIEEQFENDSDESMASTESNGDIYFNKNKNSNNSNNNNDVNQSRKDKSIVFDSDSLNRNHNDSNNSSEEEEPERDPVFLTPLPKILSNMKNNNNNNTYSNSPVIKGLSPPSSVSDYSPSSESNDCFSPLTPTNNNKINNNKINNNNSNNNSFNNSNSYRGLSPAQIIESHTPKCINRSGESKTSPFLTIRNTPSPLKNSPIKFNMSSASSLSSFDSDNDSDYNDNDIDDGEILGNPNENFTTPLKNQENNNNNNSNNSNTQYPIITSPPSNEDGDENYYFEEEEIDYEYDKRVPDWAKNHNLDNSLKQQRFYDPDRIFSMIGPVYLYEIFPKQDLGGKIKDFSKVKRNLSSDWSRDCNTEKEDISYKKNMGFTNPIIVNKK 465CDC0BC4101861 aurk-q54rn0 4 5 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component colocalization colocalization Examination of cells expressing HcpA-GFP and immunostained with anti-DdAurora antibodies revealed that DdAurora colocalized with HcpA-GFP at centromeres in metaphase (Fig. 5a) Fig. 5A, 5C, 6A, 6B, 6C, 9A. Protein [uniprotkb:Q54RN0] has undergone a significant sequence change since thisentry was originally annotated which may effect the results shown. For further information, please access the IntAct curation manual and for details of the sequence change go to unisave. DdAurora localized normally at the spindle poles and colocalized with HcpA-GFP at the centromeres of Kif12 mutant cells. aurk-icpa 4 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization In prophase, DdAurora and DdINCENP colocalized at the centromeres (arrow). Fig. 7 aurk-icpa-2 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Endogenous DdINCENP was co-purified with TAP-GFP-DdAurora but not with a TAP-GFP control Supp. Fig. 2A (Supplemental file 8). aurk-icpa-4 3 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait physical association physical association Endogenous DdAurora was immunoprecipitated (with affinity purified DdAurora antibodies) from DdINCENP null cells expressing GFP-DdINCENP. Supp. Figs. 2B, 4 (Supplemental file 8 and 10) Interaction observed in kif12-/- cells. aurk-icpa-5 2 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 3, Supplemental file 9.