I2D I2D Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Neuropsychopharmacology (0893-133X) 2007 imex curation Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database rat-brain-striatum Rattus norvegicus brian stiatum brain_striatum Brain striatum, Neostratum. confocal microscopy confocal microscopy immunostaining immunostaining Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Accepted 2010-SEP-31 by ORCHARD. Neuropsychopharmacology (0893-133X) 2007 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Neuropsychopharmacology (0893-133X) 2007 imex curation Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database rat-brain-striatum Rattus norvegicus brian stiatum brain_striatum Brain striatum, Neostratum. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Accepted 2010-SEP-31 by ORCHARD. 13-Sept-2010: Contacted by JYOTI. Neuropsychopharmacology (0893-133X) 2007 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Neuropsychopharmacology (0893-133X) 2007 imex curation Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Accepted 2010-SEP-31 by ORCHARD. 13-Sept-2010: Contacted by JYOTI. Neuropsychopharmacology (0893-133X) 2007 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Neuropsychopharmacology (0893-133X) 2007 imex curation Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunostaining immunostaining Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Accepted 2010-SEP-31 by ORCHARD. 13-Sept-2010: Contacted by JYOTI. Neuropsychopharmacology (0893-133X) 2007 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. Neuropsychopharmacology (0893-133X) 2007 imex curation Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag fluorescence tag visualisation by fluorescence tag fluorescence Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Accepted 2010-SEP-31 by ORCHARD. 13-Sept-2010: Contacted by JYOTI. Neuropsychopharmacology (0893-133X) 2007 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database cnr1_rat Cannabinoid receptor 1 Cnr1 Skr6 Brain-type cannabinoid receptor protein protein rat Rattus norvegicus (Rat) Rat MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL E59A66AFE17B646C aa2ar_human Adenosine receptor A2a ADORA2A ADORA2 protein protein human Homo sapiens Human MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS 9438E9D64A6BE61B cnr1_human Cannabinoid receptor 1 CNR1 CNR CANN6 protein protein human Homo sapiens Human MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL DIP protein P21554 original sequence version: 162 1D2E49061D12ABF2 aa2ar_rat Adenosine receptor A2a Adora2a protein protein rat Rattus norvegicus (Rat) Rat MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKGIIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAFVLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRTHVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGLGGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS D87B256CD2336BAC cb1-adora2-1 1 9 unspecified role unspecified role neutral component neutral component 6 acceptor acceptor neutral component neutral component colocalization colocalization Fig.2 cb1-adora2-2 2 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig.3 cb1-adora2-3 2 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig.3 cb1-adora2-4 3 7 unspecified role unspecified role neutral component neutral component region renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 4a cb1-adora2-5 5 7 unspecified role unspecified role fluorescence donor fluorescence donor region renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Fig. 4b cb1-adora2-6 4 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 5b