MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis for differential recognition of tyrosine-phosphorylated sites in the linker for activation of T cells (LAT) by the adaptor Gads. Structural basis for differential recognition of tyrosine-phosphorylated sites in the linker for activation of T cells (LAT) by the adaptor Gads. EMBO J. (0261-4189) 2004 Cho S., Velikovsky CA., Swaminathan CP., Houtman JC., Samelson LE., Mariuzza RA. SH2 PMID_in_GD partial coverage rapid curation unknown Unknown x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cho S., Velikovsky CA., Swaminathan CP., Houtman JC., Samelson LE., Mariuzza RA. SH2 PMID_in_GD PMID_in_GD EMBO J. (0261-4189) 2004 partial coverage rapid curation lat_human Linker for activation of T-cells family member 1 LAT 36 kDa phospho-tyrosine adapter protein p36-38 protein protein human Homo sapiens Human MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN BCD80AE7DCA64153 grap2_mouse GRB2-related adaptor protein 2 GADS protein Growth factor receptor-binding protein GRBLG GRB-2-like protein Hematopoietic cell-associated adaptor protein GrpL GRB-2-related monocytic adapter protein Adapter protein GRID Grap2 Gads Grb2l Grid Mona protein protein mouse Mus musculus Mouse MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR DIP protein O89100 original sequence version: 91 736311D0640CD3D0 grap2-lat 1 LAT_HUMAN 2 unspecified role unspecified role unspecified role unspecified role phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GRAP2_MOUSE 3 unspecified role unspecified role unspecified role unspecified role association association homomint mint grap2-lat-1 1 GRAP2_MOUSE 3 unspecified role unspecified role unspecified role unspecified role LAT_HUMAN 2 unspecified role unspecified role unspecified role unspecified role phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain association association homomint mint