IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. EMBO J. (0261-4189) 1999 imex curation Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Accepted 2009-JUL-23 by DAVET. 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 davet Only protein-protein interactions imex curation Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. EMBO J. (0261-4189) 1999 imex curation Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. davet Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Accepted 2009-JUL-23 by DAVET. 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 davet Only protein-protein interactions imex curation Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. EMBO J. (0261-4189) 1999 imex curation Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Accepted 2009-JUL-23 by DAVET. 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 davet Only protein-protein interactions imex curation Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. EMBO J. (0261-4189) 1999 imex curation Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Accepted 2009-JUL-23 by DAVET. 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 davet Only protein-protein interactions imex curation Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. EMBO J. (0261-4189) 1999 imex curation Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Accepted 2009-JUL-23 by DAVET. 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 davet Only protein-protein interactions imex curation Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system. EMBO J. (0261-4189) 1999 imex curation Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Siegers K., Waldmann T., Leroux MR., Grein K., Shevchenko A., Schiebel E., Hartl FU. uhartl@biochem.mpg.de Accepted 2009-JUL-23 by DAVET. 01-Sep-2009: Contacted by JYOTI. Actin was detected using an anti-mouse actin monoclonal antibody (Boehringer Mannheim). The specificity of this antibody in yeast was not demonstrated in this paper. EMBO J. (0261-4189) 1999 davet Only protein-protein interactions imex curation pfd6_yeast Prefoldin subunit 6 YKE2 PFD6 YLR200W L8167.8 GIM1 Genes involved in microtubule biogenesis protein 1 Gim complex subunit 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR BF66D1A9859E14B8 pfd3_yeast Prefoldin subunit 3 PAC10 PFD3 GIM2 YGR078C Genes involved in microtubule biogenesis protein 2 Gim complex subunit 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDTLFNSTEKNARGIPQAPFIENVNEIIKDPSDFELCFNKFQERLSKYKFMQESKLATIKQLKTRIPDLENTLKICQSLRNHSDEGDESDEPILLHYQLNDTLYTKAQVDIPEDRADLKVGLWLGADVMLEYPIDEAIELLKKKLADSEQSLTVSTEDVEFLRENITTMEVNCARLYNWDVQRRQDLKQAQEGTKNLKI 884D7449C7AD6233 pfd4_yeast Prefoldin subunit 4 GIM3 PFD4 YNL153C N1761 Genes involved in microtubule biogenesis protein 3 Gim complex subunit 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAKFGDNINLER 4738F9EA813E04A9 tba1_yeast Tubulin alpha-1 chain YML085C TUB1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEEEF E263B49440F71889 E263B49440F71889 pfd1_yeast Prefoldin subunit 1 PFD1 GIM6 J0488 YJL179W Genes involved in microtubule biogenesis protein 6 Gim complex subunit 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQIAQEMTVSLRNARTQLDMVNQQLAYLDRQEKLAELTKKELESYPTDKVWRSCGKSFILQDKSKYVNDLSHDETVLLDQRKTLKIKKNYLETTVEKTIDNLKALMKN C4CEF93E67D6CADC tcpa_yeast T-complex protein 1 subunit alpha TCP1 CCT1 YDR212W YD8142.13 YD8142B.04 CCT-alpha protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQLFNNSRSDTLFLGGEKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHDH 02C625D329359E61 02C625D329359E61 pfd2_yeast Prefoldin subunit 2 GIM4 PFD2 Genes involved in microtubule biogenesis protein 4 Gim complex subunit 4 YEL003W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQRNNVFQAKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGALVESDVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKIQVVKN E12DC1BE53C8C936 ch60_ecoli Chaperonin GroEL groEL 60 kDa chaperonin Chaperonin-60 GroEL protein groL mopA JW4103 b4143 protein protein ecoli Escherichia coli (strain K12) MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGGMGGMGGMM CD3A0FB505F74AD1 CD3A0FB505F74AD1 pfd5_yeast Prefoldin subunit 5 GIM5 PFD5 YML094W Genes involved in microtubule biogenesis protein 5 Gim complex subunit 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSQKIDLTKLNPEQLNAVKQQFDQELQHFTQSLQALTMAKGKFTECIDDIKTVSQAGNEGQKLLVPASASLYIPGKIVDNKKFMVDIGTGYYVEKSAEAAIAFYQKKVDKLNKESVQIQDIIKEKTQYSLSIEAQIRQAAIRQHEAMSKQQQQQQKKESSTA 24C71A33885CEE63 act_yeast Actin ACT1 ABY1 END7 YFL039C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 87AC19B0B0BC9E71 87AC19B0B0BC9E71 act1-tcp1-1 3 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey physical association physical association Anti-actin Western blot analysis of a cytosolic yeast extract (from TCP1 c-myc cells) and of anti-c-myc immunoprecipitates from extracts of TCP1 cells and TCP1 c-myc cells. Fig. 1B act1-tcp1-2 6 16 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Anti-actin Western blot analysis of a cytosolic yeast extract (from TCP1 c-myc cells) and of anti-c-myc immunoprecipitates from extracts of TCP1 cells and TCP1 c-myc cells. Fig. 1C The hetero-oligomeric TRiC complex migrated as a group of bands between 50-60 kDa grol-2 6 14 unspecified role unspecified role neutral component neutral component P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain D K Wed May 02 17:12:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp87lys' Tue Jun 30 19:23:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp87Lys' physical association physical association Assembled T-GroEL oligomer fractionates at ~800 kDa. Fig. 2B grol-act-1 2 16 unspecified role unspecified role neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role neutral component neutral component P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain D K Wed May 02 15:54:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp87lys' Tue Jun 30 20:05:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp87Lys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Determination of the binding capacity of T-GroEL in yeast cytosol for D-*actin by native PAGE. Figs. 2B, 2C grol-act-2 5 14 unspecified role unspecified role bait bait P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain D K Wed May 02 14:58:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp87lys' Tue Jun 30 18:22:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp87Lys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Determination of the binding capacity of T-GroEL in yeast cytosol for D-*actin by native PAGE. Figs. 3 grol-act-3 6 14 unspecified role unspecified role bait bait P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain D K Wed May 02 16:09:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp87lys' Tue Jun 30 18:43:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp87Lys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Determination of the binding capacity of T-GroEL in yeast cytosol for D-*actin by native PAGE. Figs. 2B, 2C gim1-gim2-1 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association In addition to the previously identified subunits Gim1p-Gim5p (Geissler et al., 1998), purified GimC contains a sixth subunit, Gim6p (open reading frame YJL179w), as determined by the isolation of the complex via a chromosomally integrated gene fusion of GIM2 with protein A, followed by mass spectroscopic analysis (Shevchenko et al., 1996) (Figure 4A). Fig. 4A gim1-gim2-2 3 16 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig. 4B gim1-gim2-3 3 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association Fig. 4C gim1-gim2-4 3 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig. 4C grol-act-4 5 14 unspecified role unspecified role bait bait P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain D K Wed May 02 14:43:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp87lys' Tue Jun 30 18:55:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp87Lys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Wild-type and Dgim1 cells expressing T-GroEL were radiolabelled for 15 min and T-GroEL immunoprecipitated, followed by DS�PAGE/autoradiography (left panel) or Western blotting with anti-actin antibody (right panel) (see Figure 3B). Fig. 6A grol-act-5 1 14 unspecified role unspecified role neutral component neutral component P0A6F5:p.Asp87Lys Abolishes ATP hydrolysis mutation mutation certain certain sequence position certain certain certain sequence position certain D K Wed May 02 15:23:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp87lys' Tue Jun 30 19:21:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp87Lys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Wild-type and Dgim1 cells expressing T-GroEL were radiolabelled for 15 min and T-GroEL immunoprecipitated, followed by SDS�PAGE/autoradiography (left panel) or Western blotting with anti-actin antibody (right panel) Figs. 3B, 6A