IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of proteins that interact with the GTP-bound form of the regulatory GTPase Ran in Arabidopsis. Characterization of proteins that interact with the GTP-bound form of the regulatory GTPase Ran in Arabidopsis. Plant J. (0960-7412) 1997 imex curation Haizel T., Merkle T., Pay A., Fejes E., Nagy F. The antibody used in the western blot detection of proteins pulled down by GST-tagged proteins was unspecific for Ran proteins (Figure 4) and therefore the experiment was not curated. nagyf@everx.szbk.u-szeged.uh 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Haizel T., Merkle T., Pay A., Fejes E., Nagy F. The antibody used in the western blot detection of proteins pulled down by GST-tagged proteins was unspecific for Ran proteins (Figure 4) and therefore the experiment was not curated. nagyf@everx.szbk.u-szeged.uh Accepted 2009-JUL-5 by JYOTI. Arabidopsis cDNA library. Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation Characterization of proteins that interact with the GTP-bound form of the regulatory GTPase Ran in Arabidopsis. Characterization of proteins that interact with the GTP-bound form of the regulatory GTPase Ran in Arabidopsis. Plant J. (0960-7412) 1997 imex curation Haizel T., Merkle T., Pay A., Fejes E., Nagy F. The antibody used in the western blot detection of proteins pulled down by GST-tagged proteins was unspecific for Ran proteins (Figure 4) and therefore the experiment was not curated. nagyf@everx.szbk.u-szeged.uh 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Haizel T., Merkle T., Pay A., Fejes E., Nagy F. The antibody used in the western blot detection of proteins pulled down by GST-tagged proteins was unspecific for Ran proteins (Figure 4) and therefore the experiment was not curated. nagyf@everx.szbk.u-szeged.uh Accepted 2009-JUL-5 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Arabidopsis cDNA library. Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation rbp1b_arath Ran-binding protein 1 homolog b RANBP1B F23F1.1 T27E13.20 At2g30060 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASISNEPERENRDEEETGANEDEDTGAQVAPIVRLEEVAVTTGEEDEDTILDLKSKLYRFDKDGSQWKERGAGTVKFLKHRVSGKIRLVMRQSKTLKICANHLVGSGMSVQEHAGNDKSCVWHARDFSDGELKDELFCIRFASVENCKAFMQKFKEVAESEEEKEESKDASDTAGLLEKLTVEEKESEKKPVEKAEENKKSEAVEEKKTEESVPSA 5F2E141A330CDAFE ran3_arath GTP-binding nuclear protein Ran-3 RAN3 Ras-related nuclear protein 3 MCO15.14 At5g55190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDLAAQQQHEAELAAAASQPLPDDDDDTFE 96648D02606EDC0B ran1_arath GTP-binding nuclear protein Ran-1 RAN1 Ras-related nuclear protein 1 F28I16.160 At5g20010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVETPALAPPEVHIDIADQQKNEAELLQAAAQPLPDDDDDIFE 672097A226E51A64 rbp1a_arath Ran-binding protein 1 homolog a RANBP1A SIRANBP Ran-binding protein siRanBP F10K1.15 At1g07140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATNEPEHEHRDEEEAGANEDEDTGAQVAPIVRLEEVAVTTGEEDEDAVLDLKSKLYRFDKDANQWKERGAGTVKFLKHKNTGKIRLVMRQSKTLKICANHFVKSGMSVQEHVGNEKSCVWHARDFADGELKDELFCIRFASIENCKTFMQKFKEVAESEEEKEESKDAADTAGLLEKLTVEETKTEEKTEAKAVETAKTEVKAEEKKESEAEKSGEAKKTEESGPST 101E45421EF5B62F ran2_arath GTP-binding nuclear protein Ran-2 RAN2 Ras-related nuclear protein 2 F28I16.170 At5g20020 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVESPALAPPEVHLDIAAQQQNEADLAAAAAQPLPDDDDDAFE 349390AC56E05AFB ran1-rbp1a 1 5 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association Table 1 We have demonstrated that the AtRanBPla and AtRanBPlb proteins interact specifically with the AtRanl protein in vivo ran1-rbp1b 1 5 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association Table 1 We have demonstrated that the AtRanBPla and AtRanBPlb proteins interact specifically with the AtRanl protein in vivo ran1-rbp1a-1 2 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P41916:p.Thr24Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T D Wed May 02 19:31:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr24asp' Tue Jun 30 18:53:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr24Asp' c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 Table 3 Figure 3 Firstly, we found that both AtRanBPla and AtRanBPlb proteins are able to bind to AtRanl, ran1-rbp1b-1 2 5 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P41916:p.Thr24Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T D Wed May 02 14:27:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr24asp' Tue Jun 30 20:16:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr24Asp' 3 unspecified role unspecified role prey prey physical association physical association Table 2 Tablee 3 Firstly, we found that both AtRanBPla and AtRanBPlb proteins are able to bind to AtRanl, ran2-rbp1b 2 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 2 Firstly, we found that both AtRanBPla and AtRanBPlb proteins are able to bind to AtRanl, as well as AtRan2 and AtRan3 proteins in vivo ran2-rbp1a 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 2 ran3-rbp1b 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Table 2 ran3-rbp1a 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Table 2