IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method. Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method. Eur. J. Biochem. (0014-2956) 1995 imex curation Geier BM., Schagger H., Ortwein C., Link TA., Hagen WR., Brandt U., Von Jagow G. Mitochondrial membranes were extracted ,complex bound to hydroxyapatite, then by gel filtration. protein separated by SDS PAGE in the presence of urea. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast chromatography chromatography technology column chromatography chromatography edman degradation edman degradation Geier BM., Schagger H., Ortwein C., Link TA., Hagen WR., Brandt U., Von Jagow G. Mitochondrial membranes were extracted ,complex bound to hydroxyapatite, then by gel filtration. protein separated by SDS PAGE in the presence of urea. Accepted 2009-OCT-21 by JYOTI. Eur. J. Biochem. (0014-2956) 1995 jyoti Only protein-protein interactions imex curation p32799-pro_0000006127 Cytochrome c oxidase subunit 13, mitochondrial COX13 Cytochrome c oxidase polypeptide VIa G1341 YGL191W protein protein yeast Saccharomyces cerevisiae Baker's yeast ASSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDD 10 129 7328A416BE9C856F cox12_yeast Cytochrome c oxidase subunit 12, mitochondrial COX12 Cytochrome c oxidase polypeptide VIb YLR038C protein protein yeast Saccharomyces cerevisiae Baker's yeast MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD 57A8FAD93756577E cox1_yeast Cytochrome c oxidase subunit 1 COX1 OXI3 Cytochrome c oxidase polypeptide I Q0045 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS 5D555084C127E8B1 p00410-pro_0000006048 Cytochrome c oxidase subunit 2 Q0250 COX2 OXI1 Cytochrome c oxidase polypeptide II protein protein yeast Saccharomyces cerevisiae Baker's yeast DVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ 16 251 A1166CF8BF16151C p04039-pro_0000006173 Cytochrome c oxidase subunit 8, mitochondrial COX8 Cytochrome c oxidase polypeptide VIII L8084.14 YLR395C protein protein yeast Saccharomyces cerevisiae Baker's yeast VHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKK 28 74 B1BE8DAE7BFEFF96 p04037-pro_0000006114 Cytochrome c oxidase subunit 4, mitochondrial COX4 Cytochrome c oxidase polypeptide IV G1362 YGL187C protein protein yeast Saccharomyces cerevisiae Baker's yeast QQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH 26 155 8EBC349E40828E2D cox3_yeast Cytochrome c oxidase subunit 3 Cytochrome c oxidase polypeptide III Q0275 COX3 OXI2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV 81B24A54F63BD8B1 p07255-pro_0000006076 Cytochrome c oxidase subunit 9, mitochondrial COX9 Cytochrome c oxidase polypeptide VIIA D2520 YDL067C protein protein yeast Saccharomyces cerevisiae Baker's yeast TIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKK 2 56 E5EA30E17CC3C599 cox7_yeast Cytochrome c oxidase subunit 7, mitochondrial Cytochrome c oxidase polypeptide VII YM9920.10C YMR256C COX7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA 5798C96AF8134D6D p00424-pro_0000006097 Cytochrome c oxidase subunit 5A, mitochondrial COX5A Cytochrome c oxidase polypeptide Va N2474 YNL2474W YNL052W protein protein yeast Saccharomyces cerevisiae Baker's yeast AQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK 21 153 FC36A22E467270E1 p00427-pro_0000006108 Cytochrome c oxidase subunit 6, mitochondrial YHR051W COX6 Cytochrome c oxidase polypeptide VI protein protein yeast Saccharomyces cerevisiae Baker's yeast SDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS 41 148 3DAFA95DE0C24584 cox1-cox3-1 1 5 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 1