MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Side chain specificity of ADP-ribosylation by a sirtuin. Side chain specificity of ADP-ribosylation by a sirtuin. FEBS J. (1742-464X) 2009 Fahie K., Hu P., Swatkoski S., Cotter RJ., Zhang Y., Wolberger C. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Fahie K., Hu P., Swatkoski S., Cotter RJ., Zhang Y., Wolberger C. FEBS J. (1742-464X) 2009 Side chain specificity of ADP-ribosylation by a sirtuin. Side chain specificity of ADP-ribosylation by a sirtuin. FEBS J. (1742-464X) 2009 Fahie K., Hu P., Swatkoski S., Cotter RJ., Zhang Y., Wolberger C. in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Fahie K., Hu P., Swatkoski S., Cotter RJ., Zhang Y., Wolberger C. FEBS J. (1742-464X) 2009 h12_bovin Histone H1.2 H1-2 CTL-1 protein protein bovin Bos taurus (Bovine) Bovine MSETAPAAPAAAPPAEKTPVKKKAAKKPAGARRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAATGEAKPKAKKAGAAKPKKAAGAAKKTKKATGAATPKKTAKKTPKKAKKPAAAAVTKKVAKSPKKAKAAKPKKAAKSAAKAVKPKAAKPKVAKPKKAAPKKK fragmentation type: fragment Histones H1 are necessary for the condensation of nucleosome chains into higher order structures mint B5D69F890B6FB5DD adprh_human [Protein ADP-ribosylarginine] hydrolase ADPRH ADP-ribose-L-arginine cleaving enzyme ARH1 protein protein human Homo sapiens Human MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL 4E23B12FAE84F12B h11_human Histone H1.1 H1-1 H1F1 HIST1H1A Histone H1a protein protein human Homo sapiens Human MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK 854B03622D78774A sir2_tryb2 NAD-dependent protein deacetylase SIR2rp1 SIR2rp1 Regulatory protein SIR2 homolog 1 SIR2 SIR2-related protein 1 Tb927.7.1690 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MTEPKLATTHVVGEPTFEGLARFIERNNITKIFVMVGAGISVAAGIPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQQPSVFYNILMDMDLWPGKYCPTTVHHFISLLAKKGMLLCCCTQNIDGLERACGIPESLLVEAHGSFSSASCVDCHAKYDINMARAETRAGKVPHCNQCGGIVKPDVVFFGENLPEAFFNVAGLIEETELLLILGTSLQVHPFADLALMVPSDVPRVLFNLERVGGRMFRFPTDRTPNFRASSYRLSTGNGNGSKISSGDSSNSSSVDGYDQFTLAENDETGVLRDIFFPGDCQVSVRSFAQALGFGEQLDASVREGREIFERTRRREKVVEG mint 046B99AAC661D650 hist1h1a-sir2rp1 1 histone H1.1 5 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation F1 mint hist1h1c-sir2rp1 1 histone H1.1 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:47:21 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Arg31Ala binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation F2B F2C mint hist1h1c-sir2rp1-1 1 TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified histone H1.1 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:47:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Arg32Ala adp ribosylation adp ribosylation reaction adp ribosylation F2B F2C mint hist1h1c-sir2rp1-2 1 TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified histone H1.1 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:50:26 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg31Ala binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:50:19 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Arg32Ala adp ribosylation adp ribosylation reaction adp ribosylation F2B F2C mint hist1h1c-sir2rp1-3 1 histone H1.1 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation F2B mint hist1h1c-sir2rp1-4 1 TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified histone H1.1 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain adp ribosylation adp ribosylation reaction adp ribosylation F2B mint hist1h1c-sir2rp1-5 1 histone H1.1 3 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified adp ribosylation adp ribosylation reaction adp ribosylation F3 mint hist1h1c-sir2rp1-6 1 TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified histone H1.1 3 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain adp ribosylation adp ribosylation reaction adp ribosylation F3 mint adprh-hist1h1a 1 histone H1.1 5 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified hADPRH 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cleavage cleavage reaction cleavage F4C homomint mint hist1h1a-sir2rp1-1 2 histone H1.1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified TbSIR2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified deacetylation deacetylation reaction deacetylation SF2C mint