MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Arabidopsis thaliana BTB/ POZ-MATH proteins interact with members of the ERF/AP2 transcription factor family. Arabidopsis thaliana BTB/ POZ-MATH proteins interact with members of the ERF/AP2 transcription factor family. FEBS J. (1742-464X) 2009 imex curation Weber H., Hellmann H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Weber H., Hellmann H. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation Arabidopsis thaliana BTB/ POZ-MATH proteins interact with members of the ERF/AP2 transcription factor family. Arabidopsis thaliana BTB/ POZ-MATH proteins interact with members of the ERF/AP2 transcription factor family. FEBS J. (1742-464X) 2009 imex curation Weber H., Hellmann H. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Weber H., Hellmann H. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation bpm6_arath BTB/POZ and MATH domain-containing protein 6 BPM6 Protein BTB-POZ AND MATH DOMAIN 6 F23N14_80 At3g43700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKLMTRTSGSSSPNTIPDQIESPTSSRSVTQTTNGSHQFVIQGYSLAKGIGVGKHIASDNFSVGGYQWTIFVYPDGKNPEDNSSYVSVFIVLASECTEVRALFELSLVDQSGKGKHKVHSHFNRSLDGGPYTLKYRGSMWGYKRFFRRSLLETSDYLKDDCLKINCTVGVVVSEMHCPRLLSIHVPDSELGSHFGKLLDTLQGSDVTFDVAGEKFQAHKLVLAARSQFFRSMFYNTLAENNSDVVISDLEPKVFKALLHFMYKDSLPGDVEPLTAHSFDLLRPSEIDDTLIVKLLAAAEMYNLSRLRLLCESHICKGISISSVSKILALSDKYNASELKSVSLKFTAENLAAVLQTKAYEDLKDDCPNLQSELLKAVAGYDDTSSSGGGKSQSVWAQLSNGGETSSRRVRQRTT AF911274AC17794D bpm1_arath BTB/POZ and MATH domain-containing protein 1 At5g19000 BPM1 Protein BTB-POZ AND MATH DOMAIN 1 T16G12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTTRVCSEVSSGSSKSLSQSLTVSTSTTETVNGFHEFKICGYSLAKGVGVGKYVASDTFMVGGYSWAIYFYPDGKSPEDNSSYVSLFIALASEGADVRALFELTLVDQSGNGKHKVHSHFGRALDSGPYTLKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRYYNIPVPVSNLGQQLGNLLESGKGCDVVFQVDGETFNAHKLVLATRSPVFNAQLFGPLGDRNTKCITIEDMEAPIFKVLLHFIYWDELPDMQELIGTDSTLASTLVAQHLLAAADRYALERLKAICESKLCEGVAINTVATTLALAEQHHCLQLKAVCLKFVALPENLKAVMQTDGFDYLKESCPSLLTELLQYVARLSEHSVIVSGHRKEIFADGCDASGRRVKPRLH 863D1AFF7068CD66 rap24_arath Ethylene-responsive transcription factor RAP2-4 Ethylene-responsive transcription factor ERF059 RAP2-4 ERF059 Protein RELATED TO APETALA2 4 F28K19.29 T11I11.1 At1g78080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAAMNLYTCSRSFQDSGGELMDALVPFIKSVSDSPSSSSAASASAFLHPSAFSLPPLPGYYPDSTFLTQPFSYGSDLQQTGSLIGLNNLSSSQIHQIQSQIHHPLPPTHHNNNNSFSNLLSPKPLLMKQSGVAGSCFAYGSGVPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTKSSKKREKKVSSPDLSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLEKYPSYEIDWDSILA mint E0A19F1DB535C372 ra213_arath Ethylene-responsive transcription factor RAP2-13 RAP2-13 ERF058 F16L1.8 Ethylene-responsive transcription factor ERF058 Protein RELATED TO APETALA2 13 At1g22190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTSMDFYSNKTFQQSDPFGGELMEALLPFIKSPSNDSSAFAFSLPAPISYGSDLHSFSHHLSPKPVSMKQTGTSAAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPDLRHNDEYQPLQSSVDAKLEAICQNLAETTQKQVRSTKKSSSRKRSSTVAVKLPEEDYSSAGSSPLLTESYGSGGSSSPLSELTFGDTEEEIQPPWNENALEKYPSYEIDWDSILQCSSLVN mint E855429BD00FB9BC bpm2_arath BTB/POZ and MATH domain-containing protein 2 F28L1.13 At3g06190 BPM2 Protein BTB-POZ AND MATH DOMAIN 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTIRVSKEVPGSSKSTAQSLTESTSRTETINGSHEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDGKSPEDNSVYVSLFIALASEGADVRALFELTLVDQSGNERHKVHSHFGRTLESGPYTLKYRGSMWGYKRFFKRSLLESSDYLKDNGLLVRCCVGVVKSRTEGPRCYNIPVPVSGLGQQFGKLLESGKGADVTFEVDGETFPAHKLVLAARSAVFRAQLFGPLRSENTNCIIIEDVQAPIFKMLLHFIYWDEMPDMQDLIGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACLKFIALPENLKAVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGHRKELFADGCDLNGRRVKQRLH D33F6BEB990262EC bpm3_arath BTB/POZ and MATH domain-containing protein 3 At2g39760 BPM3 Protein BTB-POZ AND MATH DOMAIN 3 T5I7.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVGGIEQLIPDSVSTSFIETVNGSHQFTIQGYSLAKGMSPGKFIQSDIFSVGGYDWAIYFYPDGKNPEDQSSYISLFIALASDSNDIRALFELTLMDQSGKGKHKVHSHFDRALEGGPYTLKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQGLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEPSIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEKLDVDNVATTLALAEQHQFLQLKAFCLEFVASPANLGAVMKSEGFKHLKQSCPTLLSELLNTVAAADKSSTSGQSNKKRSASSVLGCDTTNVRQLRRRTRKEVRAVS 31B93225F439926B bpm5_arath BTB/POZ and MATH domain-containing protein 5 T10F18.30 F22D1 At5g21010 BPM5 Protein BTB-POZ AND MATH DOMAIN 5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSESVIQGSNPDRVLSPTSSKSVTQTVNGSHQFVIQGYSLAKGMGIGKHIASDNFSVGGYQWGIFFYPDGKNPEDNSSYVSVFIALASEGTEVRALFELALVDQSGKGKHKVHSHFERSLDGGPYTLKYRGSMWGYKRFFRRSILETSDYLKDDCLIINCTVGVVVSEILCPQLHSVHVPDSELGSHFGVLLDSMEGSDITFNIAGEKFLAHKLVLAARSPFFKSKFFSEFEANNTEVTINDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKLSEIYETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVCLKFTAENLAAVLETDAYQQMKDECVTLQSELLKAVAGHEEGSNSTGGAKSQSVWAQLSDGGGDTTSRHVRQRTT 0AC2FE4586F092B2 bpm4_arath BTB/POZ and MATH domain-containing protein 4 BPM4 Protein BTB-POZ AND MATH DOMAIN 4 F20H23.23 At3g03740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKSVIFTEEKNLQRQNPLQKSEQQRRNFEMPSPPTTTSLSVTQTINGSHSFTIKGYSLAKGIGIGKHIASDTFTVGGYQWAIYFYPDGKNPEDNSAYVSVFIALASDGTDVRALFELSLLDQSGKGKHKVHSHFDRALESGPYTLKYRGSMWGYKRFFRRLMLETSDFLKDDCLKINCTVGVVVSEIDCPRLHSIHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLAARSPVFESEFLDVTGEEDRDIEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPSASDTLAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKFAAENLIAVMRSDGFDYLREHCPSLQSELLKTVAGCEEELSGGGGKTRSVWGQFSDGGAETNGRQAQTWGDINGGAERSQSVWVEVVNANGSGRNNNDNNNSDDPMAELED mint 5D687CF3683AC004 erf60_arath Ethylene-responsive transcription factor ERF060 ERF060 T19P19.170 At4g39780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAIDMFNSNTDPFQEELMKALQPYTTNTDSSSPTYSNTVFGFNQTTSLGLNQLTPYQIHQIQNQLNQRRNIISPNLAPKPVPMKNMTAQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAAMAYDLAAYKLRGEFARLNFPQFRHEDGYYGGGSCFNPLHSSVDAKLQEICQSLRKTEDIDLPCSETELFPPKTEYQESEYGFLRSDENSFSDESHVESSSPESGITTFLDFSDSGFDEIGSFGLEKFPSVEIDWDAISKLSES mint D489F44CFDD6D6F3 erf62_arath Ethylene-responsive transcription factor ERF062 ERF062 F18A5.10 At4g13620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MITPIHTQHSLILVYINIYSPPILSKLRTGFILWTNTQKTNKKRNMEDQFPKIETSFMHDKLLSSGIYGFLSSSTPPQLLGVPIFLEGMKSPLLPASSTPSYFVSPHDHELTSSIHPSPVASVPWNFLESFPQSQHPDHHPSKPPNLTLFLKEPKLLELSQSESNMSPYHKYIPNSFYQSDQNRNEWVEINKTLTNYPSKGFGNYWLSTTKTQPMKSKTRKVVQTTTPTKLYRGVRQRHWGKWVAEIRLPRNRTRVWLGTFETAEQAAMAYDTAAYILRGEFAHLNFPDLKHQLKSGSLRCMIASLLESKIQQISSSQVSNSPSPPPPKVGTPEQKNHHMKMESGEDVMMKKQKSHKEVMEGDGVQLSRMPSLDMDLIWDALSFPHSS mint FD9AB47CE99EC48C bpm3-rap2_4 2 RAP2-4 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM3 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a mint bpm3-rap2_13 2 RAP2-13 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM3 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a mint bpm1-rap2_4 2 RAP2-4 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a mint bpm1-rap2_13 2 RAP2-13 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a mint rap2_4-bpm1 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM1 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f1c mint rap2_13-bpm1 1 RAP2-13 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM1 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f1c mint bpm1-rap2_4-1 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated BPM1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1d mint rap2_4-bpm1-1 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM1 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction f1e mint rap2_4-bpm2 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM2 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction f1e mint rap2_4-bpm3 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM3 8 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction f1e mint rap2_4-bpm4 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM4 10 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction f1e mint rap2_4-bpm5 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM5 9 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction f1e mint rap2_4-bpm6 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BPM6 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated direct interaction direct interaction f1e mint bpm1-erf062 1 At4g13620 12 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated BPM1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction sf1 mint bpm1-erf060 1 At4g39780 11 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated BPM1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction sf1 mint bpm1-rap2_4-2 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:55:32 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 1-134 BPM1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint f2d f2c f2a rap2_4-rap2_4 1 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:54:55 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 1-134 RAP2-4 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2e mint