IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A cell surface interaction network of neural leucine-rich repeat receptors. A cell surface interaction network of neural leucine-rich repeat receptors. Genome Biol. (1465-6906) 2009 imex curation Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). High 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. I had a look at the wholemount embryo in situ hybridisation. I do not think we should include this for the following reasons: it is a whole embryo in situ (not even a section) with poor microscopic resolution, localisation with resolution to the organ level only, the pixel ovelap dosn't look too great either. Leave the remark in so we can get abck to it if atall the question arises about why the data was not included. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs predetermined predetermined participant predetermined Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). High 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. I had a look at the wholemount embryo in situ hybridisation. I do not think we should include this for the following reasons: it is a whole embryo in situ (not even a section) with poor microscopic resolution, localisation with resolution to the organ level only, the pixel ovelap dosn't look too great either. Leave the remark in so we can get abck to it if atall the question arises about why the data was not included. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk Accepted 2009-NOV-13 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. Genome Biol. (1465-6906) 2009 Only protein-protein interactions imex curation A cell surface interaction network of neural leucine-rich repeat receptors. A cell surface interaction network of neural leucine-rich repeat receptors. Genome Biol. (1465-6906) 2009 imex curation Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). High 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. I had a look at the wholemount embryo in situ hybridisation. I do not think we should include this for the following reasons: it is a whole embryo in situ (not even a section) with poor microscopic resolution, localisation with resolution to the organ level only, the pixel ovelap dosn't look too great either. Leave the remark in so we can get abck to it if atall the question arises about why the data was not included. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). High 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. I had a look at the wholemount embryo in situ hybridisation. I do not think we should include this for the following reasons: it is a whole embryo in situ (not even a section) with poor microscopic resolution, localisation with resolution to the organ level only, the pixel ovelap dosn't look too great either. Leave the remark in so we can get abck to it if atall the question arises about why the data was not included. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk Accepted 2009-NOV-13 by ORCHARD. 27-Oct-2007: Contacted by JYOTI. Genome Biol. (1465-6906) 2009 Only protein-protein interactions imex curation A cell surface interaction network of neural leucine-rich repeat receptors. A cell surface interaction network of neural leucine-rich repeat receptors. Genome Biol. (1465-6906) 2009 imex curation Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). High 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. I had a look at the wholemount embryo in situ hybridisation. I do not think we should include this for the following reasons: it is a whole embryo in situ (not even a section) with poor microscopic resolution, localisation with resolution to the organ level only, the pixel ovelap dosn't look too great either. Leave the remark in so we can get abck to it if atall the question arises about why the data was not included. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk 27-Oct-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Soellner C., Wright GJ. AVEXIS classifications were used for mapping confidence. The classifications are: A - Homophilic interaction seen in both the primary and validation screens. B - Homophilic interaction positive in either the primary or validation screen. C - Heterophilic interaction positive in both bait-prey orientations in the primary and validation screens. Positive 4 out of 4 times tested. D - Heterophilic interaction positive in both bait-prey orientations in either the primary or validation screens. Positive 3 out of 4 times tested. E - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 3 out of 3 times tested. F - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; also positive in one orientation only in validation screen (both orientations tested) but in different orientation to the primary screen. Positive 2 out of 3 times tested. G - Heterophilic interaction positive in one bait-prey orientation only in both the primary and validation screen. Positive 2 out of 4 times tested. H - Heterophilic interaction negative in both bait-prey orientations in the primary screen but positive in both orientations in the validation screen. Positive 2 out of 4 times tested. I - Heterophilic interaction positive in one bait-prey orientation in the primary screen but other orientation not tested; positive in only the same orientation in the validation screen (both orientations tested). Positive 2 out of 3 times tested. J - Heterophilic interaction negative in one bait-prey orientation in the primary screen but other orientation not tested; positive in both orientations in the validation screen. Positive 2 out of 3 times tested. Interactions were considered as high confidence when identified in the first screen and detected in both bait-prey orientations (classes A, C, D, E and F). High 2009-02-12: GJ Wright, The Wellcome Trust Sanger Institute, Hinxton, UK. I had a look at the wholemount embryo in situ hybridisation. I do not think we should include this for the following reasons: it is a whole embryo in situ (not even a section) with poor microscopic resolution, localisation with resolution to the organ level only, the pixel ovelap dosn't look too great either. Leave the remark in so we can get abck to it if atall the question arises about why the data was not included. AVEXIS a novel solid phase assay (MI:0892) to detect surface interactions was used. Ectodomains bound to rat CD4 domains 3+4 were expressed in HeLa-293E cells as a monomeric biotinylated bait, which could be captured on streptavidin-coated microtitre plates, and a pentamerised prey tagged with beta-lactamase to allow detection. The nucleotide sequence accession numbers provided were used to determine the UniProtKB Accession numbers. gw2@sanger.ac.uk Accepted 2009-NOV-13 by ORCHARD. Genome Biol. (1465-6906) 2009 Only protein-protein interactions imex curation q5bl20_danre islr2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MATKYLMLIALGTALIGNAHCCPKQCACSDKYNHQFVDCAYKDLVEVPVGLPSNASTLSLSANKIKVLKSKTFVNVTQVTSLWLAHNEIITVERDTLAPLIQLKNLDISNNKIVHFPWEDLANLGALQLLKMNNNEMVSIPKNAFSNLKDLRSIRINNNKFTTIVQGTFDSLAAMSHLQIFHNPFICSCNLEWLRDWILKSSISIPEQNNIACDAPSHLKGSQVTSMPKLNCKAPSVSITYQPNIEKTELYEGYMVMLYCETKGTPKPEVTWEIFAGNQLITFPLPAIVEKSDIPINGPPTNTRFLVFQNGTLIVPRMSKKEEGNYTCSAVNDIGKAESSVRLVVAGTKKHATNSMLDTKSPGLLPEDKLGSKGSKNSVISMRPKFEEKTKSLPTGTSVITVDKEQVDEGADTLPFVGKCGINDGTQYISNHAFNLSLDELKQYTFDFGVIALEVSETEAKVQLNPMQMANAKSNIHLSQQQDLQTVNKEPFSLFQTSAKKSPLDLLYLCVSTGNGHSVVQWSKIEEGVNAYRFQHLKPGTNYTLCLTYGGQDCQVQVVFTTRKKIPSLLIIVVVSIFLLALATVPLLGATCCHLLYKYQGKTYKLIMKTQNPDQMEKNIATDFDPRASFVGSEKNFNPSEMGEGEGEADGEEGDGEGEDIEGSVVTESIPESQSKTQEEFEVGSEYSDRLPLGAEAVNISAEINGNYKQPR F8EAE5F484063052 b8jkm0_danre lrrtm1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLMDFLLIGLYLKWPLRKPPGLILCSLGIVLKIVPLVGGSCPRLCRCDNKQLYCEGLNLTDIPQNLSSAIGLSLRENNISELREGNFVGLSQLTWLYLDHNNIEIVEESAFERLRRIKELDLSTNRIESLPNGTFRPLPNLRILDLSYNRLQSLEPDLFHGLRKLTNLHLRYNALKFIPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVNLAHFPRLISLRTLYMRNNKATIVVNTLEWTWDYLEKIDFSNNEIEYIEPHVFESVPKLNTLMLDSNKLTYIDQRILDSWTSLSSITLSGNDWECSRNVCALASWLSNFQGQRDSGLLCANPDIAQGEDILDAVYAFQLCEDNVEATTQTFTVTRNRPRGFIYEGPTKNPYDLQDMEGGEVVTNSLTVTASADDLESTMKIHKVVTGTMALIFSFLIMVLMLYVSWKCFPAGVRQLRQCFTSQRRKQKQKQTMQQMATTSASEYYVDYKPNHIDGGLVIINEYGSCKCQQQASRECEV F83D144BD9D6FB35 q6wzd2_danre rtn4rl1b ngrh2a rtn4rl1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFKRGCGLEFLLVLCGLELSWSCPRHCICYMAPSTVSCQAHNFLSVPEGIPPHSERIFLQNNKIHRLLQGHFSPTTVTLWIYSNNITYIEPSTFQGFTLLEELDLGDNRYLRSLSAETFHGLGRLHALHLYRCGLSALPNNIFQGLRNLQYLYLQDNHLEYLQDDLFVDLHNLSHLFLHGNRLWSLHQNTFRGLGALDRLLLHHNQLQWVDRLAFHDLRRLTTLYLFNNSLTELAGECLTQLPALEYLRLNDNPWECDCKALSLWDWLKKFRGSTSSVGCVAPAELAGKDLKQLRKEDFPNCSGSESLHQSKTNTWAGTNKVSLKQEPHPAQPPQTHPHHPQLNEQFPSPPSPLPQPPPAINGVQVVPGVSPDMIPDQRPGRSRNCTRQRVRGSKGKGPNEVHILKEMADKEYSSPDFTGKYDETSSNGSNTRRKHKCTPRTSVRPPSGVQQATNLGHSHHTHLFLCSISGLLTLILR 26E48E9D9AB24257 a9jrh0_danre lrrn1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MARGTFFLVVEGQICFILLLAVLGLSSVHSTECPQLCVCEIRPWFTPQSTYREATTVDCNDLHLTRIPGNLSADTQVLLLQSNYIARTSEELEQLLNLTELDLSQNNFSNIRDIGLTNMSQLTTLHLEENQIVEMPDFSLQDLTNLQELYINHNQISSIAPNAFAGLRNLLRLHLNSNRLKAIDSRWFESTPNLEILMIGENPVVGILDLNFKPLTNLRSLVLAGMELTDIPGNAFVGLDNLESLSFYDNKLVRVPQTALQKLPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSIDRFALDNLPELTKLEATNNPKFSYVSRLAFRDLPALESLMLNNNALNSLYQATADSLPNLREISIHSNPLRCDCVIQWMSSNKTTIRFMEPLSMFCTMPIEVRGQRVRDVFSREPSGQCLPMISHDTFPNHLNLDIGMTVDLDCRAMAEPEPEIYWVTPSGNKVMMDTVSDKYQLNSAGTLRISYIQVDDSGHYTCVAQNTEGADTRVTAIRVNGTLLDSTQLMKIYVKHTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTAKVPVDVHEYNLTHLQPATEYEVCLSVSNIHQQTQKSCVNVTTKHATFAVEISEQGTNTALAAVMGTILAIISLGSITLYIAKRWKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEADSEKDKDGSSDNKQTQVDTTRSYYMW E80F56FDDE53731C a8bb27_danre vasna vasn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MRPLSPLSHLILLQLLCGCLSSRCPHDCTCLPSNNIFCVQRNLIYMPRGLPSTGKQLYVFQNKINILQQQDFVELGELEMLDLSQNSLSEIPDGVFSPLSSLHNLDLSSNYITHISKDSFIGLVNLERLYLYSNIIQNIHPAAFEGLENLLELKLQGNQISVLPALQLPRLLHLDLSYNSIPPLVAQDLQTPHLESLKIAGLGLTSLDEELLGSLVNLHVLDVSQNQLVDIQPTLKSMGGLRNLNLTGNPLGSLKHEDFQNLVNLLELDLSNLNLQGFPEEFFNLFPKLEKLTAAENPFNCLCPLAWFPAWLKDVRVELLRTEETRCHFPPINSGKVLEKLEHKDFGCPTTTIELTSAGTSSTTSKPTNSSTQSGTTHIVPPAPPSDISSADADNFPVYQTTAFPSRIMEDSEGKGIMCPPNICLNGGTCIFKSNGVIVCLCPPSMSGNYCEIQNEAMLPPPSPRVSLETIATVQPNTISSHHITSTSISLDLHRYIQTRPHIRGIRLTYSNLSGPDRRPLQLSVPPSYPEYTLRGLQPNSTYSVCASPLGEPVHASVSACMEARTAGIPPSSHEPSVDRTEP 41A410DF414B04CF a8bb75_danre lrrn1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MARGTFFLVVEGQICFILLLAVLGLSSVHSTECPQLCVCEIRPWFTPQSTYREATTVDCNDLHLTRIPGNLSADTQVLLLQSNYIARTSEELEQLLNLTELDLSQNNFSNIRDIGLTNMSQLTTLHLEENQIVEMPDFSLQDLTNLQELYINHNQISSIAPNAFAGLRNLLRLHLNSNRLKAIDSRWFESTPNLEILMIGENPVVGILDLNFKPLTNLRSLVLAGMELTDIPGNAFVGLDNLESLSFYDNKLVRVPQTALQKLPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSIDRFALDNLPELTKLEATNNPKFSYVSRLAFRDLPALESLMLNNNALNSLYQATADSLPNLREISIHSNPLRCDCVIQWMSSNKTTIRFMEPLSMFCTMPIEVRGQRVRDVFSREPSGQCLPMISHDTFPNHLNLDIGMTVDLDCRAMAEPEPEIYWVTPSGNKVMMDTVSDKYQLNSAGTLRISYIQVDDSGHYTCVAQNTEGADTRVTAIRVNGTLLDSTQLMKIYVKHTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTAKVPVDVHEYNLTHLQPATEYEVCLSVSNIHQQTQKSCVNVTTKHATFAVEISEQGTNT 20BD5AE49AA385AF q503g2_danre vasna vasn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MPRGLPSTGKQLYVFQNKINILQQQDFVELGELEMLDLSQNSLSEIPDGVFSPLSSLHNLDLSSNYITHISKDSFIGLVNLERLYLYSNIIQNIHPAAFEGLENLLELKLQGNQISVLPALQLPRLLHLDLSYNSIPPLVAQDLQTPHLESLKIAGLGLTSLDEELLGSLINLHVLDVSQNQLVDIQPTLKSMGGLRNLNLTGNPLGSLKHEDFQNLVNLLELDLSNLNLQGFPEGFFNLFPKLEKLTAAENPFNCLCPLAWFPAWLKDVRVELLRTEETRCHFPPINSGKVLEKLEHKDFGCPTTTIELTSAGTSSTTSKPTNSSTQSGTTHIVPPAPLSDISSADADNFPVYQTTAFPSRIMEDSEGEGIMCPPNICLNGGTCIFKSNGVIVCLCPPSMSGLYCEIQNEAMLPPPSPRVSLETIATVQPNTISSHHITSTSISLDLHRYIQTRPHIRGIRLTYSNLSGPDRRPLQLSVPPSYPEYTLRGLQPNSTYSVCASPLGEPVHASVSACMEARTAGIPPSSHEPSVDRTEPSSSLTPIVVAVAVVMVVAIIATVVVISRRRRPKAPVDMDLHETSPLEMEGVKTNPENGLTHPKQPDITPCPSLAPNSLEYDVLLIQGQGQCPANNNIDCTKALYV 964BE87924A7C642 a8bb44_danre sc:d0342 lingo1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MVAGEVSGHSFLVACWQPILILMLGTVLSGSATGCPSRCECNVQERSVLCHRKKLMSVPEGIPSETRLLDLSKNRIKTINPDEFSAFPQLEELELNENTISAIEPGAFNNLYGLQTLGLRSNKLKLIQLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLRSLEVGDNDLVFISHRAFHGLSSLEQLTLEKCNLTSVPTEAFTHLHSLVTLRLRNLNINSIRDYSFKRLYRLKVLEIANWPYLDTMTTNCLYGLNLTSLTITNANLTSIPYLALRHLVYLRFLNMSYNPIQMIEGNRLHDLLRLQELYLVGGRLSVIEPYSFRGLNYLKVLNVSSNFLTTLEESVFHSVGNLETLALHDNPLACDCRLLWVFRRRWRLNFNRQQPTCSSPEFVQGKEFKDFPDILQPNYFTCRKSRIRDRKPQQKFVDEGTTVHFVCQADGDPTPVIMWLSPQKQFITMKTIGRLTVFPDGTLEVRYAQIQDNGTYGCIASNAGGNDTALAHLHVHSYSPDWPNQPNKTLAFISNQPNDNSINETRATVPFPFDIKT 2355E0517704E65F lig1b_danre Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B lingo1b si:ch211-116a8.1 zgc:92338 lingo1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTFLQVTIKMVAREASGHSYLVACWQPILILMLGTVLSGSATGCPSRCECSAQERSVVCHRRKLITLPEGIPIDTRLLDLSKNRLKAINPEEFLNYPQLEDLQLNENIISVIEPGAFSNLLGLRTLGLRNNNLKLIQLGVFTGLSNLTRLDISENKIVILLDYMFQELYNLKELEVGDNDLVFISHRAFHGLSSLEQLTMERCNLTSVPTEAFSHLHNLLTLKLRHLNVNVIRDFSFRRLYRLKILEIANWPLLESLTAKSLHGLNITTLSITNCNLTAVPYVAIQHLVYLRFFNLSFNPIEVVEGNKMHNLLRLQAFHLVGGRLVSIEPYSFKGLNYLRVLNVSSNSLSTLEESAFHSVGNLETLALHDNPLACDCRLLWVFRRRWRLNFNRQQPSCETPEFLQGKEFKDFPDVLPPNYFTCQKSKIRDHKAIHRFVDEGTTVQFPCQADGDPTPMIMWQSPKKQFITTKSIGRLSVSLDGTLEVRYAQIQDNGTYTCFAVNAGGNDTRLAHLHVHSYSPNWPHQPNKTFAFILNQPSDNSANGTGAMDPFPFDMKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNAKPNIEIEYVPRKVDGENSPNEGSHKISMKMI 62BFF0139DB7F628 a8bav6_danre lrrtm2 sc:d0320 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGFHSRWPLVGQAPAALCVISMLLCLPPVSCTTCPQKCRCEDLQFYCDTQGLLAPPDGVDKGALGLSLRHNSISELSSDQFFGFTQLTWLHLDHNQITTVHEDAFQGLYKLKDLNLSSNRITKLPNTTFIHLINLQILDLSFNQMTALEPELFHGLRKLQILHLRSNSLRTTPVRAFWDCRSLEYLGLSNNRLRSLARNGFAGLIKLRELHLEHNHLTKINLAHFPRLVALQFLYLQWNKINNLTSTMEWKWTTLEKLDLTGNEIRVLIPEVFETLPSLKILLLDNNKLSNLDSQTMDMWKSLNVIGLSSNLWECTKRICNLATWLSTFKGRWEHSILCYSPEYAQGEEILDAVYGFQLCQNFSAPVVLTSTSTEAMLPDITSSLFGNMQTPTQDFYAEDFGSFTIVTTTTTTTQPPRTALATTMTVEGADVTEDYSAMDNTLLTQR 2B735BFD01EFBD37 fgfr4_danre Fibroblast growth factor receptor 4 fgfr4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSILKVFIAICFMELVCSRSITSGEPRAKDIRVSRHILTPGYPENATVLVGGHVKLVCKLHQPASTRLQWFKKDSNRLGPDGSPVLTALTPLLENLSKVNIFPLVNISLEDAGEYVCKAENSAGQATRSAWVEVLSEVSEEPTEEPSEHLLLELGDVLKLRCDTNRPGAVQWFKSGVRVQHNARIQIRAAVMEIADVTYEDSGVYVCMLRGTKEALRNFTITVADAVGSGDDDDEDNGLDDIGPETENDQVYISRAPYWTHTQRMEKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGGIKLRHQHWSLVMESVVPSDRGNYSCVVENKYGSIAHTYLLDVLERSPHRPILQAGLPKNTTAIVGGDAQFLCKVYSDAQPHIQWLKHIEMNGSRYGPDGIPYVKIVKTGSLNMSEVEVLYLTNISMEDAGEYSCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKLSKFPLRRQYSVESNSSGKSSASLMRVARLSSSCSPMLAGVMEFELPYDPDWEFPRENLTLGKPLGEGCFGQVVRAEAYGINKENQDHMATVAVKMLKDDATDKDLADLISEMELMKVMDKHKNIINLLGVCTQDGPLYVLVEYASKGSLREYLRARRPPGMDYTFDVTKVPEEQLTFKDLVSCAYQVARGMEYLASKRCIHRDLAARNVLVTEDNVMKIADFGLARGVHQIDYYKKTTNGRMPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPSNCTHELYMKMRECWHAVPTQRPTFKQLVEELDRVLVSISDEYLDLSTPFEQYSPSCEDTSSSCSSDNDSVFTHDALSTEPCLLGYHDVHSRMDLKTTMR 9560EFBEDFEBDCF5 q5w433_danre siglec-4 mag protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKGLELLLLPLLLLLKDASAQWNVWMPRDISAMTNSCVVIPCSFTYPSGIRPYRGVHGIWYFGHPYPQLFPPVVLKSRTDIVHESYKGRTKLLGDLTQKNCTLLISNIGVEHSGKYYFRADLGGANIYTFPDFTKLQVLDQPNIDVPEEIVSDQSLDLTCYVPDNCPDMSPEIHWMYTDYLPDPVFTPDQVEEGNTAVLSSTLTFTPKPMHNGQLLGCRVNFPNTTYVYERLITLDIRYAPRTVWVNVSQEVMEGSSVVLHCDVDSNPAPMITWYFGDKELMSETASNSSLSLENLTPEQEGVYTCVGDNGYGNMNTSMYLAVNYPPREPWINESLTVLEGSSVSLQCTSKGNPMPTLTWLKDGELVGTITAEEGSVLELHEIMPQADGVYRCLAENDYGASSSLNITVEFAPVLLDDSKCTIVREGVQCVCIASGNPEPAIEFYLPDHVTINNSNNRFNYYTHSDGYTSTGVIKLQDKGERGNNGDTAVHVHCSITNIYGSETIRLELQQEKKYMMAVIVGTIGGVAVIAFIIAAVRYVGQNNKKENGNPGQDVGSKVENPSMFYSAVKKDKQSLRKKVLKTELLGSKFNSILEEGTGDDSDYQSVGPMAGMERQELNYAALEFLHGRHREGVFRRADGDGSDYTEIKAK 6C245EDAA1137887 a8bbg3_danre lrrtm1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLMDFLLIGLYLKWPLRKPPGLILCSLGIVLKIVPLVGGSCPRLCRCDNKQLYCEGLNLTDIPQNLSSAIGLSLRENNISELREGNFVGLSQLTWLYLDHNNIEIVEESAFERLRRIKELDLSTNRIESLPNGTFRPLPNLRILDLSYNRLQSLEPDLFHGLRKLTNLHLRYNALKFIPVRIFQDCRSMQFLDLGYNQLQSLARNSFAGLFKLTELHLEHNELVKVNLAHFPRLISLRTLYMRNNKATIVVNTLEWTWDYLEKIDFSNNEIEYIEPHVFESVPKLNTLMLDSNKLTYIDQRILDSWTSLSSITLSGNDWECSRNVCALASWLSNFQGQRDSGLLCANPDIAQGEDILDAVYAFQLCEDNVEATTQTFTVTRNRPRGFIYEGPTKNPYDLQDMEGGEVVTNSLTVTASGDDLESTMKIHK 858A4E785F33CF40 a4jyh4_danre unc5b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSTCIHRDQSPASLLGLLLLSSTLVIHADGSDYSEVLPDSFPSAPAEPLPEFQSEPEDAFIVKNRPVKLSCKAAPATQIYFKCNGEWVNQNDHVTKESLDHITGLVVREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEWSECNAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHCSGSMMESKNCTEGLCARNKKVSVEHTSHPLGSGTG 0F826DC6BFBB2913 q7sx76_danre fgfrl1a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MELLWIVFFIFDIIFITDCARGPPRVAEKIAHRQTVRIGRTMKLQCPVEGDPPPLIMWTKDGRNIHSGWMRFRVLQQALRIKEVEADDAGTFICKATNGFGSVNINYTLIVIDDSSAGREGARPAGETEYSTDLTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNPRPDIVWLKDSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAGEINATYKVEVIQRTNSKPILTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRVEPGGEGKYNSTIEVGDHHFVVLPTGDVWSRPDGSYLNKLLITRAKEEDAGMYICLGANTMGYSFRSAFLTVLPDPKPPFSPIPSVLPPSLPWPVIIGIPAGIVFILGTVLLWFCQSRKHCSSGAIISAQTLPNGHRQPPRDRPADKDCIASVAYEEYLAQQQQQQLLLAQSAPKVYPKIYSDIHTHTHSHVDGKIHQHQHIHYQC 3C2B34E5D57C332C a8bbg8_danre elfn2a ch1073-44m10.2 elfn2 sc:d0398 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MACGISLPCAVPTSFLILSLPIFLLFHAPSFVRGDCWLIEGDKGYVWLAICSQNQPPYETIPQHINNTVHDLRLNENKLKAIFFSSLSRFTNLTDLNLTKNEISYIEDGAFAGQANLQVLQLGYNKLTNLTEGMLRGLGRMQCLYLQHNLIEVIATNAFWECPSLSSLDLSSNKLAKLDASTFTVLGGRLIVCELAGNPFHCGCDLYTFLIWLEAFDNVTHTYDRLLCETPKELFGYPLVSPRGNHGRNARSILSSMCKDGVIVGGITALPPDLDSSGMEIDFYDQMGPHMQPTASSTTDPTYSPNIKLQTVSFSTASLLVQIPKPYSKMYILVQYNHTYVSDVINLKNKKQTVTLNDLKPHTNYTFCVASIRNSQRYNHTCLNFATRAPGPDDLRAGRSTTT 0954245FFA5E4DE2 a4ig39_danre zgc:162186 igsf21b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSVITLSLLLCADLLDFVIGYLTVTIEPLPPVVMGDTVTLKCNFRTDGNLREIVWFRVTEGGTSKQKIFTYDAMYNTNFSHMEDFRRREDLVYQSTVRLPEVQMEDDGPYECHVGIYDRASREKVVLASGSITLNVMSPPKSIFVEAANQPARFNRYEAQNFTLVCIVTGGKPAPVVYFKRDGEVIEVHPFASSEKVENRGLLAPKDNQPLISRELDDTKVQKSLSFMGPYSEPVRLDKDRPQRSYTSGAPTHEEPSPTTEVIPETVISREFPRWVLSSSPLYFFNQTQSELHDGTLEVQAMLTWHLNPQLDNEALFSCEVKHPALSMPMKAEVTLSAPKGPKLSVAPSRAKVGDTVRIKVEGFQMGPKANEVFPEPLFTWTRVGGPLLDGSEERFGKELVLERVPAELNGSMYRCTVQNPLGSTNTHTRLIVFENPKIKKEPTQMNFGNSARDMLGPSLMMMMLLSLTLEFT 8270752CCAA44918 a9jr35_danre Netrin receptor UNC5 unc5b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSTCIHRDQSPASLLGLLLLSSTLVIHADGSDYSEVLPDSFPSAPAEPLPEFQSEPEDAFIVKNRPVKLSCKAAPATQIYFKCNGEWVNQNDHVTKESLDHITGLVVREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEWSECNAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHCSGSMMESKNCTEGLCARNKKVSVEHTSHPLGSGTGVAVYAGLVGALLLCVILVLCVGILVYRRSCRHLHGEITDSSSALTAAFHPGNYKPPRQDNPHLLHPTAPPDLTASAGTFRGPLFSLQQATLDSHHKIPMTTSPLLDPLPSLKIKVYNSSTMSSLELPTGLGSVDGEIMSLKTVGSGPKDHHGHTLPREPSHSASATLGSLGGRLTIPNTGVGLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCAQLEPPDWTLTLKMQNHQGAWEEVLTVGEESLSSPCYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLALFAPRAPCLSLDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLVVSQLTCKICVRQVEGEGQIFQLNTDIQETLPPHSPLPAGGSCLPSSQVGPYAFRLPVSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTDGDC F5A8EAFC27AD733E a8bbb4_danre lrrc4.1 si:ch211-235l7.2 lrrc4a protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MCHIMSLLGRVAVRRARKAALLCVLFLMVQACVEVVAAAGPQGCPTDCSCNNQLSKVVCTRRGLTRVPPGIPSTTRHLNLMENAIESVQVDSFRNLHHLEVLQLGRNAIRQIEVGAFSGLTNLNTLELFDNRLTVVPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELRKLEYISDGAFEGLVNLKYLNLGMCNIRGEMPNFTPLVGLEELEISENLFPEIKPGSFRGLSSLKKLWIMNSQIGLIERNAFDDLASLVELNLAHNNLSSLPHDLYTPLKYLVELHLHHNPWNCACDSLWLARWLREYIPTNSTCCGRCHSPAHMRGRQLVELDRGDTGAMQCSAPFIADAPRDLNISAERVAELKCRTAAMSAVRWLLPNGTILTHASSHPRLTVLNDGTLNFSNVLAGDTGMYTCMVSNAAGNSNASAYLNVSAAELNTSNLSYFTTVTVEVLSPTSEMPKPKTTTTTAGASTTTTASPSVFQPVFISTPTVLLQSTDTPPSRPSVIPGSKVTTGKPPNPASTSLDEVMKTT 7C8F0555762A8F6A a8bbf4_danre islr2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MATKYLMLIALGTALIGNAHCCPKQCACSDKYNHQFVDCAYKDLVEVPVGLPSNASTLSLSANKIKVLKSKTFVNVTQVTSLWLAHNEIITVERDTLAPLIQLKNLDISNNKIVHFPWEDLANLGALQLLKMNNNEMVSIPKNAFSNLKDLRSIRINNNKFTTIVQGTFDSLAAMSHLQIFHNPFICSCNLEWLRDWILKSSISIPEQNNIACDAPSHLKGSQVTSMPKLNCKAPSVSITYQPNIEKTELYEGYMVMLYCETKGTPKPEVTWEIFAGNQLITFPLPAIVEKSDIPINGPPTNTRFLVFQNGTLIVPRMSKKEEGNYTCSAVNDIGKAESSVRLVVAGTKKHATNSMLDTKSPGLLPEDKLGSKGSKNSVISMRPKFEEKTKSLPTGTSVITVDKEQVDEGADTLPFVGKCGINDGTQYISNHAFNLSLDELKQYTFDFGVIALEVSETEAKVQLNPMQMANAKSNIHLSQQQDLQTVNKEPFSLFQTSAKKSPLDLLYLCVSTGNGHSVVQWSKIEEGVNAYRFQHLKPGTNYTLCLTYGGQDCQVQVVFTTRKKIP A53FB6A102BBE60D q5k374_danre fgfrl1b fgfrl1b alpha DKEY-149K8.2-001 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFPERGSLAFLSVLIVALSCEARGPPSVSRPVENRQTAKLGCTVRIPCPVEGDPPPLVLWVKDGRNVNPGWSRYKVLKRSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSLLDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVDPGSEDRYNSTLEVGGQHYVVLPTGDVWSRPDGSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLPWPLIIGIPAAALLIVGTIVLWLCHSRRRQSALPPRPTTYRDHHISDKEPSSPNTNKPDLPSHRLATGPATLSGPPKIYTKVYTDMHTHTHTHAHMEGKVHQHFHYQC D4DB04BA7513E1ED q90z69_danre robo3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MEFRRTLDALVVVFALICLSQGSRPRLEDAAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYKDGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPSDVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVNDKDERITIRGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEGELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGKAEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERHGQRILGIDERISLMENGTLQITALQETDSGAYTCVASSLSGETSWSGVLTVKESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTVTGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRTQDVSPTGQGVDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQYIQGYRLLYRPVGGSWSQQEVKGATERSAVIANLLKGTEYEIKIRPYFNEFQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQTRYNINQTVDGSVLSTVLKGLLPGVLYQVEVAAVTSAGVGKHSQPVSVLIKLPAEQPTVTGGGSESEENVSLAEQITDVVKQPAFIAGIGGACWVILMGFSVWIYCRRKKRKELSHYTASFAYTPAVGFPHGESSGLNGRPGMLGANMGNYPWLADSWPTTNLVHNGKDSVNCCTSKHETPERYYNEAGISNYLNQNEKYSADSNEGPIYSTIDPTSEDLRSFTAQYSQHTTPYASTPIMPFTNQAPCSPEQDGSHWMTQPGTSNAQYAQPDRSKTENVKQPKQKLMGKPVKTPSLNWMDALPPPPISGDLEQCDEEDDNELIQDMGSDEEEWCPPLPERSYLMDGMVEDGPVPPPRGEASSPTTSYSHQSTATLTPSPRDDGHFHDIPRLHQLEQPHMTRRLPCGPVPVPRAPSPPLTQSNPNLSANQECPDNTVPHRSAHKRDLSQGAAQSVENISNTTPGRARPSADHTPSGQKSKVKKKASKSAQYRRDILQGDLPPPPEPPPEDQDNCAHVGGFECGQTSLERAGSSNSSMERREQSTPNRKNSAHRRIDADDDLIPYNKPNFLSRGQMSSNCSTTGSSSSRGSTGSRGQGTGRKRNDEMR E4268BE8839DD08F a8bb35_danre lrrtm4l2 sc:d0340 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLLWEGCLSCFLLHASVLLLLSKGERMCPVSCRCEGKIVYCESGGFQDVPENISLGCQGLSLRYNSLLLLLPYQFAHLNQLVWLYLDHNSISTVDRLAFQGLRRLKELILSSNKIAQLQNGTFETVPNLRNLDLSYNQMQDLVPGHFHGLRKLQNLHLRSNNIRSIPVRTFMECRSLEFLDLGYNRLRTITRTTFLGLLRLTELHLEHNQFSRINFFLFPRLLNLQALYLQWNRIRTVVQGSPWTWHTLQKLDLSGNEIQILDPAIFRCLPNLHTLNLESNKISNVSLEVVSSWISISTINLAGNIWDCSSSICPLVSWLRNFRGTRDASIICSTPKSLQGERVMDAVRNNSVCEEMFTVEPTTELTLLLTTTTTTLYVTKPPTTTTTTPRTTTRQLSQVTHIQRLTPKVLLPVRPEKEFLTVTPSSLPFTPEPEFEHMTFHK E2F9D3B247C1A94A q3mkm9_danre vasna slitl2 vasn protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MRPLSPLSHLILLQLLCGCLSSRCPHDCTCLPSNNIFCVQRNLIYMPRGLPSTGKQLYVFQNKINILQQQDFVELGELEMLDLSQNSLSEIPDGVFSPLSSLHNLDLSSNYITHISKDSFIGLVNLERLYLYSNIIQNIHPAAFEGLENLLELKLQGNQISVLPALQLPRLLHLDLSYNSIPPLVAQDLQTPHLESLKIAGLGLTSLDEELLGSLVNLHVLDVSQNQLVDIQPTLKSMGGLRNLNLTGNPLGSLKHEDFQNLVNLLELDLSNLNLQGFPEGFFNLFPKLEKLTAAENPFNCLCPLAWFPAWLKDVRVELLRTEETRCHFPPINSGKVLEKLEHKDFGCPTTTIELTSAGTSSTTSKPKNSSTQLGTTHIVPPAPPSDISSADADNFPVYQTTAFPSRIMEDSEGEGIMCPPNICLNGGTCIFKSNGVIVCLCPPSMSGNYCEIQNEAMLPPPSPRVSLETIATVQPNTISSHHITSTSISLDLHRYIQTRPHIRGIRLTYSNLSGPDRRPLQLSVPPSYPEYTLRGLQPNSTYSVCASPLGEPVHASVSACMEARTAGIPPSSHEPSVDRTEPSSSLTPIVVAVAVVMVVAIIATVVVISRRRRPKAPVDMDLHETSPLEMEGVKTNPENGLTHPKQPDITPCSSLAPNSLEYDVLLIQGQGQCPANNNIDCTKALYV 4E197E063AF3608C a8bb40_danre lrrtm4l1 sc:d0341 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGSLACDMRLAGLLLLQASSLLLFSSGERMCPYSCHCEGKIVHCESSAFQDIPENISVSCQGLSLRYNDLHTMLPYQFAHLNQLLWLYLDHNQIMFVDSRAFQGLRRLKELILSSNRISQLHNVTFHGVPNLRSLDLSYNKLQELQPGQFYGLRKLQNLHLRSNGLTAIPVRAFLECRSLEFLDLGYNRLRVLTRTAFLGLSRLMELHLEHNQFSRINFFLFPRLANLRALYLQWNRIRAVNQGLPWSWYTLQRLDISGNEIQVLDPVVFQCLPNLQVLNLESNKLANVSQEVVAAWISLTTISLAGNMWDCGPGICPLVVWLKNFRGTKDTNIICSSPKHLQGEKVIEASKNYIDCDDYESTAQSPLYLQTFDPNYDLALEPTEPTMAPTTPPPPLPSPASEAPFPPSQSRPPHRPTFPSRTNTDPRDSHQRTPSSFDSSLVTPVPEQDNVSFHK CF9C4DF9B4644CBA a8bbd5_danre elfn1b elfn1 sc:d0369 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MTEAQMSISSGSNGHRGGMVTSALLCWAVALVFLSLTRVPVVQGDCWLIEGEKGFVWLAICSQNQPPYENIPMHINSTIVDLRLNENKIRSIHFSSLSRFGNLTYLNLTKNDISYIEDGAFSAQFNLQVLQIGFNKMRNLTEGMLRGLGRLQYLYLQANLIETVTANAFWECPAIENIDLSMNRIQQLDGATFRGLSKLTTCELYANPFSCSCELLGFLRWLVAFPNRTSERMACDTPAGFSGYSLLSQNPRMPRYRNAFHALSSVCTDDNVTPYLHGSPDGGIPTRLPDLSPCGLDDCSSGTFPEETISISPTFLDSDARPIMKLKEVTHTSAVITIQIPNPFRKMYILVLYNNSFFTDIQNLKSQREEIELQNLKSHTNYTYCVASIRNSLRFNHTCLTISTGPRTLQERVVNDSTAT 9539F5982898C532 a4jyh1_danre robo2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLTHLLLCGLVYFNQVAGSRLRQEDSPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGAYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECVPPRGHPEPTIYWKKDKVRIDEKDDRIKIRGGKLMISNTRKSDAGMYICVGTNMVGERDSETAQVTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPSIRWKKDDVEIPRGRYDMKFDKDDFTLRIKKATASDEGTFTCVAENRVGKMEASATLTVRAAPQFVIRPRDQIVAQGRTASFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITAVQRADAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIIRQGPANQTLGVDSVALLRCHASGEPVPTISWLKDGVSLLGKDPRMSLQDLGSLQIKGLRLSDSGIYTCVAASSSGETSWSAFLEVKEAGSLVVVKDRDENELPGPPSKPQVTDVTKNSVSLSWQPGLPGASAISTYVIEAFSQSVSNSWQTVADHVKTTQYTIKGLRPNTIYLFMVRAVNVQGLSDPSPMSEPVRTQDISPPAQGVDHRHVQKELGEVIVRLHNPVVLSPTTIQVTWTVDRQSQFIQGYRVLYRQMSGLSSPGAWQTQDVKVPSERSMVLSALKKGIVYEIKVRPYFNEFQGMDSESRTARTTEEAPSAPPQQVTVLTVGNQNSTSISISWDPPPAEHQNGIIQEYKIWCLGNETRFHVNKTVDAAIRSVVVGGLQAGVQYRVEVAASTSAGVGVKSEPQTIIIGKDFRDVMISRNNSTTEQITDVVKQP F699CC91EBEE3AC2 a4jyg3_danre mag protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MKGLELLLLPLLLLLKDASAQWNVWMPRDISAMTNSCVVIPCSFTYPSGIRPYRGVHGIWYFGHPYPQLFPPVVLKSRTDIVHESYKGRTKLLGDLTQKNCTLLISNIGVEHSGKYYFRADLGGANIYTFPDFTKLQVLDQPNIDVPEEIVSDQSLDLTCYVPDNCPDMSPEIHWMYTDYLPDPVFTPDQVEEGNTAVLSSTLTFTPKPMHNGQLLGCRVNFPNTTYVYERLITLDIRYAPRTVWVNVSQEVMEGSSVVLHCDVDSNPAPMITWYFGDKELMSETASNSSLSLENLTPEQEGVYTCVGDNGYGNMNTSMYLAVNYPPREPWINESLTVLEGSSVSLQCTSKGNPMPTLTWLKDGELVGTITAEEGSVLELHEIMPQADGVYRCLAENEHGRASSSLNITVEFAPVLLDDSKCTIVREGVQCVCIASGNPEPAIEFYLPDLNVTINNSNNRFNYYTHSDGYTSTGVIKLQDKGERGNNGDTAVHVHCSITNIYGSETIRLELQQEKK 22630928A9456F50 a4jyg1_danre fgfrl1b protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFPERGSLAFLSVLIVALSCEARGPPSVSRPVENRQTAKLGCTVRIPCPVEGDPPPLVLWVKDGRNVNPGWSRYKVLKQSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSLLDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVDPGSEDRYNSTLEVGGQHYVVLPTGDVWSRPDGSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLP 2A0F7098ECF9B0EA a8bbf0_danre flrt1a sc:d0372 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MMAPEGIGELRDLLFLLLLCFTLLAELLEMTAASSQGLDGEDDIVCPSVCRCDEDFIYCNDRGLSAIPPLPPSATVLYLQNNHIDNAGLPRSLEYHTTVRVIYLYDNELDDFPMHLPPSIRELHLQDNNIRVLPRAALARLPLLEKLHLDDNSVSTVSIEDQAFADNPRLRLLFLSRNHLSSIPSGLPASLEELRLDDNRISTIPTHAFRGLSSLRRLVLDGNLLANQRIADDTFSRLSNLTELSLVRNSLQTPPLNLPSAHLQRLSLQDNNLIHVPRGSLDGMRRLQRLDLSGNNLTTLPRGLFRDLDTLGQLLVRGNPWHCGCNLRWLHDWLEAKGNTITVRGFICLTPERVRDMALRDLTNQMDECELAAAGGGGVGAGVGVGGNRMSGGAVSTTLSPPQGSLFTLRSKRPGLGLPDSGLDYTLSSSGVGKNLALNVKPLSHDSIRVTWSVAQTSSSFRLSWLRLGTSSAMGSITETLVRGDRREYLLTSLQPASSYIICMVPLVSNSGSRSGLPGGDAESNDVPVCARTETSDPNQPDDEQGETEGSDQMTSLP 12077214EFED46D0 a8bav0_danre flrt1b sc:d0318 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MATESLVELRDWLFLLLLCLTLLVEVLEFAAATAAAAEAALGEAELQGEVPCPSACRCDDGFIYCNDRGLTLIPPLPLTAAVLYLQNNRIDNAGLPTSLERRLTVRVVYLYDNELDDFPTHLPPSLRELHLQDNNIRTLPRSALARLPLLEKLHMDDNSISTVSIEDKAFTNNPRLRLLFLSRNHLSSIPSGLPASLEELRLDDNRISTIPTHAFRGLSSLRRLFLDGNLLANQRIADDTFSRLSNLTELSLVRNSLQAPPLNLPSLHLLRLYLQDNAIAHMPRGSLDGMRRLQKLDISGNNLTTLPRGLFKDLDSLSQLLVRGNPWYCGCNLRWLHDWLHERGSSVTVRGLTCHAPERLRGMALRDLSSQLEDCEVTVDAAGGMVGNEVAKKEKGYFPTQPPATTTPPLPQGSLFTLRSRRPGHKYSDMGQDSLGGGNGFVSKSLLISVKPLTPETVHITWQAAQPVPSFRLSWLRLGNSPAMGSITETLVPGDRREYLLTQLQPQSSYIICLVPLAGNDGKRTSFTATGGLNINTNSEHEHPACAKTETDPLEQPMSDQDSDRGTDALSALP 0B5D3548EEF911AE a4jyd4_danre boc protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MSGTLNWIPWERKRKIRVLCSLCVLLFCLQDSNAVTDDVPVFTEEPFSVVQKLGGSVTLRCSALPNHVNISWHLNGRELPAGGDEELGVLVRPGSLYIPSLTNLTVGRYQCVATTSVGSCASVPANVTAAKLRDFEPDDQQEIEVDEGNTAVIECHLPESQPKAQVRYSVKQEWLETSKGNYLIMPSGNLQIANATRDDEGPYICAAYNPVTQEIKTSTSTDRLRIRRSTSEAARIIYPPASRSIMVNKGQRLVLECVASGIPTPQVTWAKDGLDLRNHNNTRFLLSNLLIDAASESDSGTYVCLADNGIGSTSSAQVLYDVQVFEPPQVRVELQQQDVAWGDTVRFSCQVRGKPAPTVVWLHNAQPLSPSPRHRVSAQVLRVLNVGPQDDGMYQCMAENGVGSSQAATRLLTLPTVPSRKMPMIRPLSPDKVLREQPPLKPPVSTSAVLPFDCSEVRVSPAEAPVILSQPRTGKADYYELTWKPRHDGGAPVLEYIIKYRKAGESPGEWTTNTISGSQHKLILTKLQPASLYEVEMAARNCAGLGQPAMMTFRTGKWRRGGPIGPPKTPVVQPRLSPPEAPDRPTVSMATETSAYVTWIPRGNRGFPIQSFRVEHKKLRKGSGDWEVAVNNIPPSRLSVEVTGLEKGTSYKFRVLAVNVLGASPPSAPSKAYTVVGSGPPNRRPIDGPYITYNEAINETTIILKWTYTPLNNTPIYGFYIFYRPTDSDNDSDYKKDVVEGDRYWHSITDLQPETAYDIKMQCFNEGGESEFGNVVILETKARPHQRTTPPETASSRPEHPGNPVPRPGDLPYLIVGVVLGAFVFIIVAFIPICLWRVWAKQKQTLDMRFPTLAATVSPCQYTMVPL 062FE3BA9E11441A a4jyd3_danre robo3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLRYLIKTLLQMNLFTDTIRDATNGTDLFFNISSIPSFNSSLLDWANFTGLNGSRPRLEDAAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYKDGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPSDVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVNDKDERITIRGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEGELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGKAEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERDGQRILGIDERISLMENGTLQITALQETDSGAYTCVASSLSGETSWSGVLTVKESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTATGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRTQDVSPTGQGVDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQYIQGYRLLYRPVGGSWSQQEVKGATERSAVIANLLKGTEYEIKIRPYFNEFQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQTRYNINQTVDGSVLSTVLKGLLPGVLYQVEVAAVTSAGVGKHSQPVSVLIKLPAEQPTVTGGGSESEENVSLAEQITDVVKQPAFIAGIGGACWVILMGFSVWIYCRRKKRKELSHYTASFAYTPAVGFPHGESSGLNGRPG 6C14DC7A599E9F32 q90z70_danre robo2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGPLTHLLLCGLVYFNQVDGSRLRQEDSPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGAYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECVPPRGHPEPTIYWKKDKVRIDEKDDRIKIRGGKLMISNTRKSDAGMYICVGTNMVGERDSETAQVTVFERPTFLRRPTNQVVLEEEAVEFRCQVQGDPQPSIRWKKDDVEIPRGRYDMKFDKDDFTLRIKKATASDEGTFTCVAENRVGKMEASATLTVRARPVAAPQFVIRPRDQIVAQGRTASFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITAVQRADAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIIRQGPANQTLGVDSVALLRCHASGEPVPTISWLKDGVSLLGKDPRMSLQDLGSLQIKGLRLSDSGIYTCVAASSSGETSWSAFLEVKEAGSLVVVKDRDENELPGPPSKPQVTDVTKNSVSLSWQPGLPGASAISTYVIEAFSQSVSNSWQTVADHVKTTQYTIKGLRPNTIYLFMVRAVNVQGLSDPSPMSEPVRTQDISPPAQGGDHRHVQKELGEVIVRLHNPVVLSPTTIQVTWTVDRQSQFIQGYRVLYRQMSGLSSPGAWQTQDVKVPSERSMVLSALKKGIVYEIKVRPYFNEFQGMDSESRTARTTEEAPSAPPQQVTVLTVGNQNSTSISISWDPPPAEHQNGIIQEYKIWCLGNETRFHVNKTVDAAIRSVVVGGLQAGVQYRVEVAASTSAGVGVKSEPQTIIIGKDFRDVMISRNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVQSFTFTPAVTFQRVDGGLMSNGSRPGLLNASDSGYPWLADSWPPSLPVNSGSGGPNDLSFGRGDVMPSAQADKTGTMLSDGAIYSSIDFTTKGGFGSPSPASQATPYATTQILHSNSIHELAVDLPEAQWKTSLQAKQEMASLGYSLPDKNSCNNTLLFIPDYRLADGLSNRMPHNQSQDFSTTSSHNSSDRSNSLSGGKGGKKKKTKANVKPTKMNGSNWANVPLPPPPIHPLPGTEMDHYASEHHDGGGYDSDGWGPPLPVQTYLHQGLEDELEEEEERVPTPPIRGVASSPAAVSFGKQSTATLSPSPREEMQPMLQAHLDELTRAYQLDMAKQTWHMQGGPYPPQAPAPPVGYISSTLVSDIETDLPDEDDDDEEDEGYEMSPPIRGTEHTPGSSMDNLDSSVTDKGLPHRPRPASPFSTDGSTVGTHSLGHQRAARPTRKHKGPGTVPNRRDASADDLPPPPEPPPCQTARIPGSRNVPHPCDRKASSLERQPMMGLEEMRSSLDRQARTSLDRHQQVQDRLGSIERGDESRRGQKNGPFSEEALLPYNKPSFPSPGGHSSSGTASSKGSTGPRKGEGTRGQHQRSTTEQGESSYMGTNAQFSGEL D1743BACCCC089F0 a8bax6_danre rtn4rl1b rtn4rl1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MFKRGCGLEFLLVLCGLELSWSCPRHCICYMAPSTVSCQAHNFLSVPEGIPPHSERIFLQNNKIHRLLQGHFSPTTVTLWIYSNNITYIEPSTFQGFTLLEELDLGDNRYLRSLSAETFHGLGRLHALHLYRCGLSALPNNIFQGLRNLQYLYLQDNHLEYLQDDLFVDLHNLSHLFLHGNRLWSLHQNTFRGLGALDRLLLHHNQLQWVDRLAFHDLRRLTTLYLFNNSLTELAGECLTQLPALEYLRLNDNPWECDCKALSLWDWLKKFRGSTSSVGCVAPAELAGKDLKQLRKEDFPNCSGSESLHQSKTNTWAGTNKVSLKQEPHPAQPPQTHPHHPQLNEQFPSPPSPLPQPPPAINGVQVVPGVSPDMIPDQRPGRSRNCTRQRVRGSKGKGPNEVHILKEMADKEYSSPDFTGKYDETSSNGSNTRRKHKCTPRTSVRPP 05C74B2FBBE92B18 a8bbj6_danre lrrc4ca lrrc4c protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MINKMTSSLMQQTMRGPRWNRALSDPLFVLSLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICTRRGLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLSKNHIRNIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSIIRPGSFKGLVHLQKLWMMHAQIQTIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHHLERVHLHHNPWNCNCDILWLSWWLKEMVPANTSCCARCSSPTSHKGRYIGELDQNYFHCYAPVIVEPPADLNVTEGMAAELKCRANSLTSVSWITPNGSIMTHGAYKIRISVLNDGTLNFTNVTMQDTGTYTCMVSNSAGNTTASATLNVSSTENSSFSYFTTVTVETTEAPPDEGHPTVQQKNGPTPSSGIWETLPPSFTTTTTTARTPLSTKATDKTYTIPVTAQSDGSLNTLDEVMKT 1D8FB832E907B104 a8bbf9_danre flrt3 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MASNYMSFFVFFIRAGLLLGLANPLMTSASCPSQCRCDGTFIYCNDRDLTSIPSGIPEDATVLFLQNNRIKSAGIPTDLRRLNGVEKIYLYCNNLDEFPTNLPLNVKELHLQENNIRTITHASLAQIPFIEELHLDDNSVSAVSIEEGAFRDSNHLRLLFLSRNHLSTIPSGLPMTIEELRFDDNRISSISEASLQDLINLKRLVLDGNLLNNRGIGEMALVNLVNLTELSLVRNSLTSPPANLPGSSLEKLNLQDNHINHVPPGAFAFLRQLYRLDLSGNNLSSLPMGVFEDLDNLTQLLLRNNPWHCNCRMKWVRDWLRTLPSKVNVRGFMCQGPDKVKGMAIKDLSTELFGCSDTEIPTTYETSTVSNTLPPSRPQWPSYVTKRPVVKGPDLGRNYRSTTPSSRKIITISVKSSSAETVHISWRVSQPMTALRLSWLKLGHSPAFGSITETIVQGERTEYLLTALEPESSYRICMVPMETSNIYLSDETPVCIETETGSLKAYNPTTTLNREQEKEPYKNSNLP 84C58119A02A5D8D a8bb30_danre lrrc24 si:ch211-215e19.1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDPGQMSAVLVLMLAQLSSTSLACPSGCRCYSLTVECGSIGIKEIPQGITQGTQTIFLQDNAIGQIRQRDLSDLGQLHYLYLQNNSISTLEPGAFRSLGLLLELALNGNRIHLITADVFRGLDHLRILYLAGNQINRLEDYTFRGLQRLQELHLQENVLEVLGDQALVGLSSLALLDLSRNNLRTLSPASLKPLVSLQVLRVTDNPWRCDCALHWLRGWINEEGQRLLSSAERRMLCAEPPRLSHLSLVEVPPNSLVCIPPVVQLEPSHLTVRLGESLRVSCQASGYPQPQVTWRKASHGKAQLSPRGLVQEVGMDGDTRNGGRLVTARPGGKGGPSSHGPIRGGADDGADRENFDPDTGSGMLFLSNVTVAHAGRYECEAWNPGGVARVTFHLSVNMSSSSSRSEIWPRLHSSSYYHPSSVDVSQEPLYELESMDFNALGTAT DD66A1E4ABE75B9C a4jyd8_danre Receptor protein-tyrosine kinase fgfr4 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MLSILKVFIAICFMELVCSRSITSGEPRAKDIRVSRHILTPGYPENATVLVGGHVKLVCKLHQPASTRLQWFKKDSNRLGPDGSPVLTALTPLLENLSKVNIFPLVNISLEDAGEYVCKAENSAGQATRSAWVEVLSEVSEEPTEEPSEHLLLELGDVLKLRCDTNRPGAVQWFKSGVRVQHNARIQIRAAVMEIADVTYEDSGVYVCMLRGTKEALRNFTITVADAVGSGDDDDEDNGLDDIGPETENDQVYISRAPYWTHTQRMEKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGGIKLRHQHWSLVMESVVPSDRGNYSCVVENKYGSIAHTYLLDVLERSPHRPILQAGLPKNTTAIVGGDAQFLCKVYSDAQPHIQWLKHIEMNGSRYGPDGIPYVKIVKTGSLNMSEVEVLYLTNISMEDAGEYTCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKLS 6A19779C008909DE lrrtm2-lrrtm2 3 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score A author score author-based confidence author score High lrrtm1-lrrtm1 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score A author score author-based confidence author score High flrt1a-flrt1a 3 33 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 33 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score A author score author-based confidence author score High lrrtm3a-lrrtm3a 3 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score A author score author-based confidence author score High lrrtm3b-lrrtm3b 3 26 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 26 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score A author score author-based confidence author score High nlrr1-ngl1 3 39 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 9 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High unc5b-flrt1b 3 17 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 34 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High unc5b-flrt1a 3 33 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 17 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High islr2-slitlike2 3 8 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 23 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High lrrtm2-lrrtm1 3 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score C author score author-based confidence author score High lrrtm1-lrrtm3a 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High lrrtm1-lrrtm3b 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 26 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score C author score author-based confidence author score High unc5b-flrt3 3 40 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 17 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score D author score author-based confidence author score High unc5b-islr2 3 17 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 23 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score D author score author-based confidence author score High lrrtm1-fgfrl1b 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 32 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score D author score author-based confidence author score High lrrtm3a-lrrtm3b 3 26 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score D author score author-based confidence author score High elfn2-igsf21 3 19 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 20 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score E author score author-based confidence author score High lrrtm1-boc 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 35 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score E author score author-based confidence author score High lrrtm1-fgfrl1a 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 18 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score E author score author-based confidence author score High ngl1-nlrr1 3 39 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High flrt1b-unc5b 3 34 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 17 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High flrt1a-unc5b 3 33 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 17 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High slitlike2-islr2 3 27 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 23 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score C author score author-based confidence author score High lrrtm1-lrrtm2 3 13 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score C author score author-based confidence author score High lrrtm3a-lrrtm1 3 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score C author score author-based confidence author score High lrrtm3b-lrrtm1 3 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 26 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score C author score author-based confidence author score High flrt3-unc5b 3 40 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 17 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score D author score author-based confidence author score High islr2-unc5b 3 17 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 23 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score D author score author-based confidence author score High fgfrl1b-lrrtm1 3 16 unspecified role unspecified role prey prey betalactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 24 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score D author score author-based confidence author score High lrrtm3b-lrrtm3a 3 26 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score D author score author-based confidence author score High igsf21-elfn2 3 19 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 20 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score E author score author-based confidence author score High boc-lrrtm1 3 16 unspecified role unspecified role prey prey beta lactamase binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 35 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score E author score author-based confidence author score High fgfrl1a-lrrtm1 3 18 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score E author score author-based confidence author score High robo3-elfn1 3 25 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 29 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score F author score author-based confidence author score High boc-lrrtm3a 3 35 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score F author score author-based confidence author score High elfn1-robo3 3 36 unspecified role unspecified role prey prey 29 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score F author score author-based confidence author score High lrrtm3a-boc 3 35 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score F author score author-based confidence author score High lingo1a-lingo1b 3 12 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 11 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score G author score author-based confidence author score Low nlrr1-ngl2 3 9 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 22 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score G author score author-based confidence author score Low lrrtm2-lrrtm3b 3 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 26 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score G author score author-based confidence author score Low lrrc24-robo2 3 41 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 30 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score G author score author-based confidence author score Low lrrtm1-rtn4rl1 3 16 unspecified role unspecified role bait bait region l-glutamyl-5-poly(adp-ribose) L-glutamyl-5-poly(ADP-ribose) L-glutamyl-5-poly(ADP-ribose) L-isoglutamyl-poly(ADP-ribose) MOD_RES PolyADP-ribosyl glutamic acid (S)-2-amino-5-poly[2'-adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with 1alpha-D-ribofuranosyl]oxy-5-oxopentanoic acid ADP Ribose addition ADP-Ribosyl O-ADP-ribosylation (on Glutamate or C terminus) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 38 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score H author score author-based confidence author score Low lrrtm3a-lrrc24 3 41 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score H author score author-based confidence author score Low flrt3-mag 3 40 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 31 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score H author score author-based confidence author score Low elfn2-boc 3 19 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 35 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score I author score author-based confidence author score Low flrt3-boc 3 40 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 35 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score I author score author-based confidence author score Low lrrtm1-fgfr4 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 42 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score J author score author-based confidence author score Low robo2-lrrtm1 3 30 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score K author score author-based confidence author score Low lrrtm2-lrrtm3a 3 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score K author score author-based confidence author score Low lrrtm1-mag 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 31 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score L author score author-based confidence author score Low rtn4rl1-lrrtm1 3 38 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score H author score author-based confidence author score Low lrrc24-lrrtm3a 3 41 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score H author score author-based confidence author score Low mag-flrt3 3 31 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 40 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score H author score author-based confidence author score Low fgfr4-lrrtm1 3 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 14 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score J author score author-based confidence author score Low lrrtm1-robo2 3 16 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 30 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association author score author-based confidence author score K author score author-based confidence author score Low lrrtm3a-lrrtm2 3 13 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score K author score author-based confidence author score Low mag-lrrtm1 3 31 unspecified role unspecified role bait bait region l-glutamyl-5-poly(adp-ribose) L-glutamyl-5-poly(ADP-ribose) L-glutamyl-5-poly(ADP-ribose) L-isoglutamyl-poly(ADP-ribose) MOD_RES PolyADP-ribosyl glutamic acid (S)-2-amino-5-poly[2'-adenosine 5'-(trihydrogen diphosphate) 5'->5'-ester with 1alpha-D-ribofuranosyl]oxy-5-oxopentanoic acid ADP Ribose addition ADP-Ribosyl O-ADP-ribosylation (on Glutamate or C terminus) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role prey prey beta lactamase enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association author score author-based confidence author score L author score author-based confidence author score Low unc5b-flrt1a-1 2 33 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey direct interaction direct interaction 3 Equilibrium binding analysis of Unc5b and three Flrt paralogs K off is 7.2 micromoles/second. unc5b-flrt1b-1 2 34 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey direct interaction direct interaction 3 Equilibrium binding analysis of Unc5b and three Flrt paralogs K off is 0.6 micro moles per second. unc5b-flrt3-1 2 21 unspecified role unspecified role prey prey 40 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 3 Equilibrium binding analysis of Unc5b and three Flrt paralogs K off is 5.5 micro moles per second. lrrc4a-lrrn1 1 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region bound to beads with tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization additional data file 2 islr2-vasn 1 10 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2 lrrtm1-robo2-1 1 37 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2 flrt1b-unc5b-1 1 34 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2 rtn4rl1-lrrtm1-1 1 5 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2 fgfrl1a-lrrtm1-1 1 5 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2 lrrtm2-lrrtm1-1 1 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2 lrrtm4l1-lrrtm1 1 5 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2 flrt3-mag-1 1 40 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association additional data file 2